KEGG   Caldicellulosiruptor kronotskyensis: Calkro_0890Help
Entry
Calkro_0890       CDS       T01357                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
ckn00010  Glycolysis / Gluconeogenesis
ckn00030  Pentose phosphate pathway
ckn00051  Fructose and mannose metabolism
ckn00052  Galactose metabolism
ckn00680  Methane metabolism
ckn01100  Metabolic pathways
ckn01110  Biosynthesis of secondary metabolites
ckn01120  Microbial metabolism in diverse environments
ckn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkro_0890
   00030 Pentose phosphate pathway
    Calkro_0890
   00051 Fructose and mannose metabolism
    Calkro_0890
   00052 Galactose metabolism
    Calkro_0890
  Energy metabolism
   00680 Methane metabolism
    Calkro_0890
Enzymes [BR:ckn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Calkro_0890
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Calkro_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADQ45762
UniProt: E4SDF3
Position
complement(1068365..1069612)
Genome map
AA seq 415 aa AA seqDB search
MPKEGNCVVAQSGGPTAVINASLLGVIEEAMKQHPIRAIYGAKNGIIGLIDEELYDLRME
DPEELKLLKTTPSSALGSCRYQLKPFEHDEKDYIKIFNVFEAHNIRYFFYIGGNDSMDTA
DKLTRYAQKIGYDICIIGIPKTIDNDLVMTDHCPGFGSAAKYIATSVMEIARDAVVYPTN
IVTIIEVMGRNAGWLAAASALASKDIGAPDLIYLPEVPFSIDKFLDDVRNIHKKTGKITI
VVSEGIKDKEGKYIADMSHKFGIDAFGHVQLGGAAFVLENIIREEVEKRVKSIQFNVLQR
SAAHIMSKTDVEEAYMVGRMAVRYAVEGACGYMVAIKRDSDNPYSSSTELVELNKVANAE
KLVPLAWISHDGNYVKEDALNYIQPLIEGEVEVKYERGLPRYAKLRKIMVPKKVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagaaggtaactgcgtggttgcgcaatcaggaggaccaactgctgtcatcaac
gcatcgcttttaggtgttattgaagaagctatgaaacagcacccaattcgtgctatttat
ggtgctaaaaatggaatcattggacttattgatgaagagctttatgacctcagaatggaa
gaccctgaagagctaaaacttttaaagacaactccatcctctgccttaggttcttgcagg
tatcagctcaagccttttgaacatgatgaaaaagactatatcaagatttttaatgtattt
gaggcgcataacattcgctactttttctatataggcggaaacgactcaatggatacagct
gataagcttacacgatacgcgcagaaaattgggtatgacatctgcataatcggaattcca
aagacaattgacaacgaccttgtgatgacagaccactgtccgggttttggaagtgctgca
aagtacattgcaacatctgtgatggaaattgcaagagatgcagttgtgtatccgacaaac
attgttactataattgaagtgatgggaagaaatgctggttggcttgcagcagcatctgct
ctggcatccaaagatataggtgcaccagatttaatatacctccctgaggttccattttcc
attgacaagtttttggatgatgtaagaaatattcacaagaaaactggaaagattaccatt
gttgtatcagaaggtattaaagacaaagaaggcaaatatattgctgatatgagccacaag
tttggaatagacgcgtttggacatgtacagcttggcggagcagcatttgttttagagaac
atcatccgcgaagaagtggaaaagagagtaaaatcaattcaattcaacgtgctacagcga
agtgctgctcacatcatgtccaaaactgatgttgaggaagcatacatggttggacgcatg
gcagtaaggtatgcggttgaaggtgcttgtggatacatggtagcaataaaacgcgacagt
gacaatccttattcaagttcaacagaacttgttgagctgaacaaggttgcaaacgctgaa
aagcttgtcccgcttgcgtggatttctcatgacggcaactatgtaaaagaagacgcttta
aattatatccagccactaattgaaggtgaagttgaagtcaagtacgaaagaggccttcct
cgatatgcaaagctcagaaagataatggttccaaagaaggttgtataa

DBGET integrated database retrieval system