KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1006Help
Entry
Calkro_1006       CDS       T01357                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
ckn00010  Glycolysis / Gluconeogenesis
ckn00020  Citrate cycle (TCA cycle)
ckn00620  Pyruvate metabolism
ckn00633  Nitrotoluene degradation
ckn00640  Propanoate metabolism
ckn00650  Butanoate metabolism
ckn00680  Methane metabolism
ckn01100  Metabolic pathways
ckn01120  Microbial metabolism in diverse environments
ckn01130  Biosynthesis of antibiotics
ckn01200  Carbon metabolism
Module
ckn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkro_1006
   00020 Citrate cycle (TCA cycle)
    Calkro_1006
   00620 Pyruvate metabolism
    Calkro_1006
   00640 Propanoate metabolism
    Calkro_1006
   00650 Butanoate metabolism
    Calkro_1006
  Energy metabolism
   00680 Methane metabolism
    Calkro_1006
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calkro_1006
Enzymes [BR:ckn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calkro_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_6 Fer4_16 Fer4_7 Fer4_9 Fer4_21 Fer4_10 Fer4_2 Fer4_17 Fer4_4 Fer4_8 Fer4_3 Fer4_13 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ADQ45877
UniProt: E4SB95
Position
1166638..1167657
Genome map
AA seq 339 aa AA seqDB search
MLPTTNELGYYEIRLESIGGLGANVAGKILAEAGVVGSGLNALNFASYGSEKKGSPVKSY
IRFAPKEKHIRINSPVVQPHLVAIFHENMVNTNPVTQGLRKDGIVILNTNKSVDEARDFL
KLASGTVATVDAIRIALEVKTRINMVMLGAIVRMLGFISLDSVKEIVKQTFEKKYPQTIA
SNMAGLEAGYNYVESKFFEYDGKYQYVEYQEERRPMGYKNAPIGGTIVEFANTITKNNIT
SRIGKIPVFIKEKCINCGLCETTCPDYVFVWDRKVENGKSKMFNLGPDYQYCKGCLRCVD
ICPTGALVEGIEREYDIEKISAKHDFDIYEKWYEDGEKR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttacctactacaaacgaacttgggtactacgaaattcggcttgaaagtattggtgga
cttggtgcgaatgttgcaggcaaaattttggctgaagcaggtgttgttggaagtggactg
aatgccttaaattttgcaagttatggctctgaaaagaaaggttcgcctgtaaagtcatat
ataagatttgctccaaaggaaaagcatataagaattaattcgcctgttgttcagcctcat
ttggttgctatatttcacgagaatatggtaaatacaaaccctgtcacacaaggacttaga
aaagatggaatagttatcctaaacacaaacaagagcgtggatgaggctcgtgacttttta
aaacttgcaagtggcacggtggcaacagtggatgcgataaggattgctcttgaagttaaa
acaaggattaacatggttatgcttggggcaattgtaagaatgcttggatttattagctta
gatagtgtaaaagagattgttaaacaaacttttgagaaaaaatatccgcagacaattgcg
tccaacatggcaggtcttgaagctggatataactatgtagaatctaagttttttgaatat
gatggtaaatatcagtacgtagagtaccaggaagaaagaagacctatgggatacaagaac
gctccgattggaggaactattgtagagtttgcaaacacaataacaaaaaacaatataacc
agcaggattgggaaaattcctgtatttataaaagaaaaatgcatcaactgtgggctttgt
gaaacaacatgccctgattatgtctttgtttgggatagaaaggtagaaaatggtaagtca
aaaatgtttaatttagggcctgattatcagtattgtaaaggatgtcttagatgtgttgac
atttgtcctacaggtgcacttgttgaaggtattgaaagggaatatgacatagaaaaaata
tctgcaaaacatgattttgatatatacgaaaaatggtatgaggatggtgagaagagatga

DBGET integrated database retrieval system