KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1025Help
Entry
Calkro_1025       CDS       T01357                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
ckn00260  Glycine, serine and threonine metabolism
ckn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ckn01100  Metabolic pathways
ckn01110  Biosynthesis of secondary metabolites
ckn01130  Biosynthesis of antibiotics
ckn01230  Biosynthesis of amino acids
Module
ckn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calkro_1025
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calkro_1025
Enzymes [BR:ckn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calkro_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB DUF627 BtpA
Motif
Other DBs
NCBI-ProteinID: ADQ45896
UniProt: E4SBB4
Position
1188259..1189029
Genome map
AA seq 256 aa AA seqDB search
MNLIDERFEKLKKEGKKAFIGYVTFGYPTFEETLWFIKLVYSYVDILEIGFPFSDPIADG
EIIQKASIKALSEGVKLSHLFESIEKFKKDKPVVLMLYANTVYKKGIDRFFESCKACGVD
GVIIPDVSFEESFEFKESAEKFGVTYIDLVSISSLERAKMIGRQSRGFLYCVSRKGVTGF
KGQIDDRIFTFLKELKTVTSTPLAVGFGIKSKEDVQKFKDLADGIVIGSAIITKIDEGKD
KLEDFLKEISESLKHK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatagatgaaagatttgaaaagctaaaaaaagagggaaaaaaagctttcata
ggctatgttacgtttgggtatccaacttttgaagaaacactttggtttataaagcttgta
tattcatatgtagacattttagagattggttttcctttttctgaccctattgcagatgga
gaaattattcaaaaagcttctataaaagctctcagtgaaggtgtcaaattgagccacctt
tttgaaagcattgaaaagtttaaaaaagataagccggttgtgctaatgttgtatgcaaac
acagtttacaaaaagggaattgataggttttttgaaagttgcaaagcttgcggtgtggat
ggcgtgataatcccagatgtttcgtttgaagagagctttgagtttaaagaatcagctgaa
aagtttggtgttacttatattgaccttgtatcaatatcttctcttgagagagcaaaaatg
ataggtaggcagagccgcggttttttgtattgtgtttcaagaaaaggcgtgacaggtttc
aaagggcagattgatgatagaatctttacttttctaaaagaactgaaaaccgttacatca
acacctttggcagttggatttggtataaagagtaaagaagatgttcagaagttcaaagac
cttgcagatggtattgtcattggaagcgcaataatcacaaagatagatgaaggaaaagac
aagcttgaagattttttgaaagaaatctctgaaagtctaaaacacaaataa

DBGET integrated database retrieval system