KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1928Help
Entry
Calkro_1928       CDS       T01357                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
ckn00010  Glycolysis / Gluconeogenesis
ckn00020  Citrate cycle (TCA cycle)
ckn00620  Pyruvate metabolism
ckn01100  Metabolic pathways
ckn01110  Biosynthesis of secondary metabolites
ckn01120  Microbial metabolism in diverse environments
ckn01130  Biosynthesis of antibiotics
ckn01200  Carbon metabolism
Module
ckn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkro_1928
   00020 Citrate cycle (TCA cycle)
    Calkro_1928
   00620 Pyruvate metabolism
    Calkro_1928
Enzymes [BR:ckn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Calkro_1928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding CAT Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADQ46772
UniProt: E4SG97
Position
complement(2105768..2107129)
Genome map
AA seq 453 aa AA seqDB search
MATPVIMPKQGQTVESCIITKWHKKKGDKVEVGDLLFSYETDKASFDEEAKVSGVLLDIF
FEEGEEVPVLTNVCVIGEPGEDVLKFNPKTFLEAQKDDISHLQTSEQDMPMETQAKIPGD
YSPIEGKIKISPRAKNLAEKLNVDFRFAKPSGPDGRIIERDILKLFKSGPVFTAAAKQEA
KEIEEANVLESTGIGGRVTTFDIERAKQESYVSKTSESSVQNVEYEDVPLSNIRKAIAKA
MYVSLTTTAQLTLHTSFDASKVLEFRKKVKENKEKLGLEDITINDIILFAVSRVLPKHKS
LNSHFLDDKMRYFKNVHLGFAVDTERGLMVPTIFNCNQKSLSQISKEAKELIGLCKKGTI
SPDLLKGATFTVTNLGSFGIESFTPVLNPPQTGILGVNTIVQRPKEEDGHIKFYPAMGLS
LTFDHRALDGADAAKFLKDLKEFLENFDLLLAL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctgtaataatgcccaagcaagggcagactgttgaaagttgtataattaca
aagtggcacaagaaaaaaggtgataaggttgaggttggcgaccttttattttcttatgag
accgacaaggcaagctttgatgaggaagcaaaggtaagtggtgtgcttcttgacattttt
tttgaagagggtgaagaggttcctgtcttgacaaatgtgtgtgtgattggtgaacctggt
gaggatgtacttaagttcaatccaaagaccttcttggaagctcaaaaagatgacatctca
catttgcagacatctgaacaagatatgccgatggaaactcaagcaaaaattccaggtgac
tattctccaattgaagggaaaataaaaatttcgcctagggcaaagaacttagctgaaaaa
ttaaatgttgattttaggtttgcaaaaccttcaggaccagatggaagaataattgaaaga
gatattttaaaactttttaaatcaggtccagtgttcacggctgcggcaaagcaggaagca
aaagaaattgaagaggctaatgttttagaatcaactggcattggtgggagagtcacaact
tttgacattgaaagggcaaagcaggaaagctatgtctcaaaaacttctgagtcttctgta
cagaatgtagaatatgaagatgtgccgctatctaacatcagaaaggcaatcgcaaaggct
atgtatgtatctcttaccacaacagctcagctgacattacatacatcatttgatgcaagt
aaagtccttgagtttagaaagaaagtaaaagaaaacaaagaaaaactgggacttgaggat
ataacaataaacgatataatcctttttgctgtctcaagggttttaccaaaacacaaatcg
ctcaatagccattttttggatgataaaatgagatatttcaaaaatgttcatcttgggttt
gcagttgatacagagcgtggtcttatggtgccaacaatattcaattgtaaccaaaagagt
ttgagtcaaatctcgaaagaagcaaaggagctaattggcctttgcaaaaaaggaacaatc
tcaccagaccttttaaaaggagcaacattcactgtcactaacttaggaagctttggcata
gaaagttttacacctgtcctaaatcctcctcagacagggattttaggtgtaaatacaatt
gtccaaaggcctaaggaagaagatggacatataaaattctatccagcgatgggactatca
ctaacatttgaccacagggcgttagatggagccgatgcagcaaagtttttgaaggattta
aaggagtttttagaaaactttgatttgcttttggcactctga

DBGET integrated database retrieval system