KEGG   Caldicellulosiruptor kronotskyensis: Calkro_2165Help
Entry
Calkro_2165       CDS       T01357                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
ckn00052  Galactose metabolism
ckn00561  Glycerolipid metabolism
ckn00600  Sphingolipid metabolism
ckn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Calkro_2165
  Lipid metabolism
   00561 Glycerolipid metabolism
    Calkro_2165
   00600 Sphingolipid metabolism
    Calkro_2165
Enzymes [BR:ckn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Calkro_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 Melibiase_2
Motif
Other DBs
NCBI-ProteinID: ADQ47003
UniProt: E4SGX8
Position
complement(2357898..2360087)
Genome map
AA seq 729 aa AA seqDB search
MPITFNPQTNMFFIEAKNTSYVIKLFKGKFLSHVYWGKKIKEFEWTDFDVTGGRAFGATP
DPNDKTYTFDTMLLEYPAYGNSDFRHPAFQVEQEDGSCITNLVYKTHRIYDGKPKLEGLP
ATYVESPDEAQTLEIELYDDLIGLKVTLTYTAFRDFDTITRSVRFENLGKQTLKILRAMS
ACVDFPEGDFELLHLWGSWARERFIERTPLIHGTQIIDSARGESSHQHNPFIALLSKGAT
EKFGDVYGFSLVYSGNFAAIVEKDQYNLVRVTMGINPFEFTWVLEPQSSFQTPEVVMVYS
QEGLGGMSRTYHKLYRKRLCRGAYRDKRRPILINNWEATYFNFNEEKLLSLAKEAKDLGI
ELFVLDDGWFGKRDDDTSSLGDWFVDRRKLPNGLDGLGKKLNEMGLKFGLWFEPEMVSPD
SELYRKHPDWCIQVRGRTLTQCRNQYVLDITREDVRKEILRMMKEILKAAPIEYIKWDMN
RPLTEVGSLDLPPERQKEVFHRYVLGLYQMMEELTYEFPYILFEGCSGGGGRFDPGILYY
MPQIWTSDDTDAIERLKIQFGTSIVYPASTMGAHVSIVPNHQVGRITPMKTRGVVALSGA
FGYELDLTKLSQEDKEEIKKQIEIYKRIWHIVLKGDLYRLISPFEENAAAWMFVTEDKNE
AVVFYVEILRQPNPPIKRLKLDGLDPSKSYLIEGEQKTRFGDELMNIGLMIPQMWGDFNS
HIWILKAVD
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgccaataacctttaacccacagacaaatatgtttttcatagaagcaaagaacacaagc
tatgtgataaagcttttcaaaggaaagtttttgtcccatgtttattgggggaaaaaaatt
aaagaatttgagtggacagattttgatgtgacaggaggaagagcatttggtgcaacacct
gacccaaatgacaaaacatacacatttgatacaatgcttttggagtaccctgcatatgga
aattcagatttcaggcatcctgcatttcaagtagagcaggaagacggctcttgtatcaca
aaccttgtttacaaaacacacagaatttatgatggaaagccaaaacttgaaggtcttcca
gcaacatatgttgagtcacctgatgaggctcaaacactggagatagaactttatgatgat
ttgattggtttgaaagttacattgacatatacagctttcagagattttgatacaataaca
aggagtgtaaggtttgagaacttaggaaaacaaactctcaaaatccttcgtgcaatgagc
gcatgtgttgatttcccagaaggggacttcgaacttttgcacctgtggggttcatgggca
agagagagattcatagagagaacccctcttatccatggaactcagataattgacagcgca
agaggtgaaagttcacatcagcacaatccatttatagcacttttatcaaagggtgcgacc
gaaaagtttggagatgtttatgggttttctcttgtctacagtggtaattttgctgcaatt
gtagagaaagaccaatacaatctggtaagagtgactatgggaataaatccatttgagttt
acatgggttttagagccgcaaagcagttttcagacaccagaggttgtgatggtttattca
caagagggcttgggagggatgtctcgcacataccacaagctttacagaaaaagactttgc
agaggagcatatcgggataaaagaagaccaattctgattaacaactgggaggctacatat
ttcaatttcaatgaagaaaaacttctttctttggcaaaagaggcaaaagatcttgggatt
gagctgtttgttttagatgatggttggtttggtaaaagagacgatgatacaagctcactt
ggagactggtttgttgacagaagaaagcttccaaacggtttggacgggcttgggaaaaag
ttaaatgaaatggggctcaaatttggactgtggtttgagcctgagatggtctcaccagac
agcgaactttacagaaagcatcctgattggtgcatacaggtacgaggaagaacgttgaca
caatgcagaaaccagtacgttttggacatcacaagagaagatgttagaaaagaaatttta
aggatgatgaaagagattctaaaagcagctccaattgaatatatcaagtgggacatgaac
aggcccttaacagaggtaggttcgcttgaccttccaccagaaagacaaaaagaggtcttc
cacaggtatgtacttggactttatcagatgatggaggagctcacttatgagtttccatac
atcttatttgaaggatgttctggcggtggtggaaggtttgacccgggaattttgtattac
atgcctcaaatttggacaagtgatgacacagacgcaatcgaaaggcttaaaatccagttt
ggaacaagcatagtttatcctgcatcaactatgggtgcgcatgtatcaattgtgccaaac
catcaggttggtaggataacaccaatgaaaacaagaggggttgtagcactttcgggtgct
tttggatatgaacttgatttgacaaagctatctcaagaggataaagaggagataaaaaag
caaattgagatttacaagagaatatggcatatagtgcttaaaggtgatttgtacaggcta
atttccccatttgaagaaaatgcagctgcttggatgtttgtaacagaagataaaaatgag
gcggttgtattctatgtggaaattttaaggcagccaaacccaccaatcaaaaggttaaaa
ttagatggtcttgaccccagcaagagctatttgattgaaggtgagcaaaaaacaaggttt
ggcgatgagcttatgaacattgggcttatgattcctcaaatgtggggtgattttaattct
catatttggatactgaaagcagttgattag

DBGET integrated database retrieval system