KEGG   Citrobacter koseri: CKO_00481Help
Entry
CKO_00481         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
cko  Citrobacter koseri
Pathway
cko02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cko00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CKO_00481
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cko02000]
    CKO_00481
Enzymes [BR:cko01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     CKO_00481
Transporters [BR:cko02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    CKO_00481
   Histidine transporter
    CKO_00481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 AAA_16 ABC_ATPase AAA_23 PRK G-alpha AAA_33 FtsK_SpoIIIE RsgA_GTPase AAA_24 NACHT AAA_22
Motif
Other DBs
NCBI-ProteinID: ABV11637
UniProt: A8ADS4
Position
461133..461906
Genome map
AA seq 257 aa AA seqDB search
MSENKLNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
SIVVSGQNISLVRDNDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKHEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGDPEQVF
GNPQSPRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaataaattaaacgttatcgatttgcacaagcgctacggcgaacatgaggtg
ctgaaaggggtatcgctacaggctaacgccggagatgtgatcagtattatcggatcgtct
ggctccggtaagagtacctttctgcgctgtattaacttcctcgaaaaaccgagcgaaggg
tcgattgtggtgagcggccagaatatttccctggtgcgtgataacgacggccagctcaag
gtcgccgataaaaaccagctgcggttgctgcgtacgcgcctgacgatggtatttcagcac
ttcaatctctggagccacatgacggtgctggagaacgttatggaagcgccgattcaggtg
ctgggattaagcaaacatgaagcgcgcgagcgtgcggtgaaatacctggcgaaagtcggt
attgatgaacgtgcgcagggaaaatacccggtacacctctccggtggtcagcagcagcgc
gtctcaattgcccgcgcgttggcgatggaacctgaggtgctgctgtttgatgagccgaca
tcggcgcttgaccccgaactggtaggcgaagtcttgcgtatcatgcagcagttagcggaa
gaggggaaaacgatggtggtggtgacgcatgaaatggggtttgcccgccatgtttccacc
catgtgattttcctgcatcaggggaaaatcgaagaagaaggcgatccagagcaggtattt
ggcaacccgcaaagcccgcgtttgcaacagttcctgaaaggctcgctgaagtag

DBGET integrated database retrieval system