KEGG   Citrobacter koseri: CKO_00504Help
Entry
CKO_00504         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K08722  5'-deoxynucleotidase [EC:3.1.3.89]
Organism
cko  Citrobacter koseri
Pathway
cko00240  Pyrimidine metabolism
cko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CKO_00504
Enzymes [BR:cko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.89  5'-deoxynucleotidase
     CKO_00504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_3 HD_2 HD HDOD
Motif
Other DBs
NCBI-ProteinID: ABV11660
UniProt: A8ADU7
Position
complement(480496..481095)
Genome map
AA seq 199 aa AA seqDB search
MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQVNAER
IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPDELRDIFAPLI
DEHAYSEEEKSVVKQADALCAYLKCLEELSAGNNEFLLAKTRLEKTLASRRSEEMDYFMA
VFVPSFHLSLDEISQDSPL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagagccatttttttgcccacctctcccgcctgaaactgattaaccgctggcca
ttgatgcgcaacgtgcgcaccgaaaacgtctccgaacacagtttgcaggtggcgatggtc
gcccacgcgcttgccgctatcaaaaatcgcaaattcggcggccaggtcaatgccgagcgt
attgcgctactggcgatgtaccacgatgcctctgaagtgttgaccggcgatctcccgacc
ccggtgaaatacttcaattcgcaaatcgcgcaggaatacaaagcgattgagaaaattgct
cagcaaaaactggtggatatggttcctgacgaactgcgcgatatttttgcaccgctgatc
gacgaacatgcttacagcgaagaagagaaatcggttgtgaagcaagccgacgcgctttgc
gcctatctgaagtgtctggaagagttatcggcgggcaataatgaattcctgctggcaaaa
acgcgactggaaaaaaccctggcgtcgcgccgcagcgaagagatggactattttatggcg
gtgtttgtgcccagttttcacctctcgctggatgaaatcagccaggattcgccgctataa

DBGET integrated database retrieval system