KEGG   Citrobacter koseri: CKO_00565Help
Entry
CKO_00565         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cko  Citrobacter koseri
Pathway
cko00020  Citrate cycle (TCA cycle)
cko00620  Pyruvate metabolism
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
cko01130  Biosynthesis of antibiotics
cko01200  Carbon metabolism
Module
cko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cko_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKO_00565
   00620 Pyruvate metabolism
    CKO_00565
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CKO_00565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABV11720
UniProt: A8AE07
Position
550641..552302
Genome map
AA seq 553 aa AA seqDB search
MKKVTAMLFTMAVGLNAVSMAAKAKATEEQETDVLLIGGGIMSATLGTYLQELEPEWSMT
MVERLDGVAQESSNGWNNAGTGHSALMELNYTPKKADGSVSIEKAVDINEAFQVSRQFWA
HQVQSGVLHEPHSFINTVPHMSFVWGDDNVNFLRARYTALQQSTLFRGMRYSEDHAQIKE
WAPLVMEGRDPKQKVAATRTEIGTDVNYGEITRQLVASLQKKPNFALQLNTEVRGFKRNA
DNSWTVTVADLKNGEAEHAIKAKFVFIGAGGAALKLLQETGIPEAKDYAGFPVGGQFLVS
ENPDVVNNHLAKVYGQASVGAPPMSVPHIDTRILDGKRVVLFGPFATFSTKFLKNGSLWD
LLSSTTTSNFMPMVNVGMDNFDLVKYLISQVMLSDDERFEALKEYYPQAKKEDWRLWQAG
QRVQIIKRDEDKGGVLRLGTEVVSDKDGTIAALLGASPGASTAAPIMLHLMEKVFKEKVA
SPEWQAKLKTIVPSYGTKLNGNIEATEQELQYTSDVLGLKYDKPQVVDEAPKPQLKPQVQ
PQPAHKAVADIAL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgactgccatgctcttcaccatggctgtggggctgaatgctgtctcgatg
gcggcaaaagcgaaagcgaccgaagagcaggaaacggatgtactgttgattggcggcggc
atcatgagcgccacgttgggaacctatttgcaggagctggaaccggagtggtcaatgacc
atggttgagcgactggatggggttgcacaggagagttccaacggctggaacaacgccgga
acaggccactccgcgctgatggaactgaactacacgccgaaaaaagccgacggttccgtc
agcatcgaaaaggcagtcgacattaacgaagccttccaggtttcccgccagttttgggcg
catcaggtacagagcggcgttctgcacgaaccacactcgtttatcaataccgttccgcac
atgagctttgtctggggcgatgataacgtcaatttcctgcgcgcccgctataccgcgttg
cagcagagcacgctgttccgcggtatgcgttactccgaagatcatgcgcaaattaaagag
tgggcgccgctggtcatggaaggtcgcgacccgaaacagaaggttgccgcgacccgcact
gaaatcggtactgacgtgaactacggggaaatcacacgtcagctggtggcatcgttgcag
aaaaaaccgaactttgcgctgcaactgaataccgaagtccgtggatttaaacgtaacgcg
gataactcctggaccgtgaccgtcgccgatctgaaaaacggtgaagcagaacatgcgatt
aaggcgaaatttgtctttatcggcgcgggcggcgcggcgctgaagctgttgcaggagacg
ggcattcctgaagcgaaagattacgcgggattcccggttggcggccagttcctggtttca
gagaacccggatgtggttaacaaccacctggcgaaggtatacggccaggcgtcggtcggc
gcaccgccgatgtccgtaccgcacatcgatacccgtattctggatggcaaacgcgtcgtg
ctgtttgggccgttcgcgacgttctccacgaagttcctgaaaaacggttcgctgtgggat
ctgctgagttcgaccacgacctctaactttatgccgatggttaacgtagggatggataac
ttcgatctggtgaaatacctgattagccaggtgatgctgagcgatgatgaacgctttgaa
gcgctgaaagagtactatccgcaggcgaagaaagaagactggcgtttgtggcaggcgggc
cagcgcgtgcagatcatcaagcgtgatgaagacaagggcggcgtactgcgtctgggcact
gaagtggtcagcgacaaagacggtacgattgccgcgctgctgggcgcgtctccgggggca
tccactgctgcgccgatcatgctgcatctgatggaaaaagtgtttaaagagaaagtggcc
agcccggaatggcaggcgaagctgaaaacgattgttccgtcttacgggactaagctgaac
ggcaatattgaggccacggaacaagagctgcaatacaccagcgacgttctggggctgaaa
tatgacaagccgcaggtggtggacgaagcgccaaaaccgcagcttaagccgcaggttcaa
ccgcagccggcgcataaagctgtcgcggatatcgcgctgtaa

DBGET integrated database retrieval system