KEGG   Citrobacter koseri: CKO_00755Help
Entry
CKO_00755         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00996  undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6]
Organism
cko  Citrobacter koseri
Brite
KEGG Orthology (KO) [BR:cko00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cko01005]
    CKO_00755
Enzymes [BR:cko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.6  undecaprenyl-phosphate galactose phosphotransferase
     CKO_00755
Lipopolysaccharide biosynthesis proteins [BR:cko01005]
 O-antigen
  CKO_00755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf CoA_binding_3 PglD_N
Motif
Other DBs
NCBI-ProteinID: ABV11907
UniProt: A8AEJ4
Position
729898..731334
Genome map
AA seq 478 aa AA seqDB search
MDTDNFLNKYNPLLCKVFLAASDFIFFNLSLALSIGCVYWIFNDLYRFIPDAQLEMRIIS
HVILSLICVGWFWVRLRHYSYRKPFWFELKEIIRTIVIFAVFDLALVAFSKWQFSRYVWV
FCWTFALILLPLFRAMTKQLLNRLGIWKKKTVIMGSGSNAVEAYYALQSEEMLGFDVVAF
YDEECTEATLQGLPVLQDPNILWEMKKTGDIHFIVAFEMENSDKTINWLRELSKKDCRSV
TVIPSLRGLPLYNTDMSFIFSHEVMLLRIHNNLAKRTSRFLKRTFDIVCSSLIILISSPL
LIYLWYKVTRDGGPAIYGHMRVGRHGKLFPCYKFRSMVMNSQEVLQKLLDSDPAAREEWE
RDFKLKNDPRITPVGRFIRKTSLDELPQLFNVLKGQMSLVGPRPIISEELPRYDENVDYY
LMAKPGMTGLWQVSGRNDVDYDTRVYFDSWYVKNWSLWNDIAILFKTVKVVLHRDGAY
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggatacggataattttttgaataaatataatccattgctatgcaaggtttttctcgca
gcatcggattttatattttttaacttatcactggccctctctattggttgtgtatactgg
atttttaacgatctttatcgttttatccccgatgctcaactggagatgcgtataatttct
catgtcatcctgagcttgatatgtgtgggatggttctgggttcggttgcgacattattcc
tatcgcaaacccttttggtttgaattgaaggagattatccgcactattgtgatctttgct
gtttttgatctggcgctggtcgctttttctaaatggcaattttctcggtatgtatgggtc
ttttgttggacgtttgcattaattctgctgccgcttttccgagcaatgaccaaacaactt
cttaatcgtcttgggatttggaagaaaaagactgtcattatgggtagcggaagtaatgca
gtggaagcttattatgcactgcaaagtgaggaaatgcttggctttgatgttgtcgcattt
tatgacgaagagtgtacagaggcaacgctacagggactgccggttcttcaggaccccaat
attctttgggaaatgaagaaaacaggcgatattcatttcattgtagcttttgaaatggaa
aacagcgataagaccattaactggttgcgcgaactatcgaagaaggactgccgttctgtc
acggttattccgtccctgcgcgggttaccactttataataccgatatgtctttcatcttt
agtcatgaagtcatgttgctgcgtattcataataatctggcaaaacggacatctcgtttc
cttaaacggactttcgatattgtctgttcatcactgattatcttaatttcttcgccactg
ctcatttatctttggtacaaagttacccgtgatggtggtccggcaatctacggtcatatg
cgagtaggacgtcacggtaagcttttcccttgctataagtttcgctcaatggtgatgaat
tcgcaggaggttttacaaaagctccttgattccgatcctgccgcacgggaagaatgggag
cgtgactttaagttgaaaaacgatccgcgaatcactcctgtcggtcgatttattcgtaaa
accagtcttgatgaattgcctcagttatttaatgtgctgaaaggtcaaatgagtctggtt
ggcccgcgtccgattatctctgaagagttaccacgctatgatgagaatgttgattactat
ctaatggcgaaaccgggaatgacagggttgtggcaggtaagtggacgtaacgatgtggat
tacgatacccgagtctactttgactcctggtatgtcaagaactggtcgctgtggaatgac
atcgctattcttttcaaaactgtgaaggtagtcctccatagagatggtgcatattga

DBGET integrated database retrieval system