KEGG   Citrobacter koseri: CKO_00898
Entry
CKO_00898         CDS       T00592                                 
Name
(GenBank) hypothetical protein
  KO
K03194  type IV secretion system protein VirB1
Organism
cko  Citrobacter koseri
Pathway
cko03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cko00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CKO_00898
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cko02044]
    CKO_00898
Secretion system [BR:cko02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   CKO_00898
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-ProteinID: ABV12048
UniProt: A8AEY5
Position
complement(884053..884763)
AA seq 236 aa
MLSTTAFLAIAMQCAASIHPSTAFDVARVESGFNPYAIAEIVPKAGPSFGDQHIISHLPA
SRGDAEHILRRLSAQDRRYSVGLMQITSTNFRHYGVSATELLDPCTNLSVFEHILRDCYR
RGGTLKRALSCYYSGNFSTGQQPETAFSGTSYIQRIGYPPGSSRYAVPGTREDKSSVAVP
LKTAPASDSSRHHVIWPGVVVRGVPAKLRQEKIFIAPFSAPSVRRSFSLSPREEEE
NT seq 711 nt   +upstreamnt  +downstreamnt
atgctttccaccacagcctttctggcgatagccatgcagtgcgccgccagcattcatccg
tccacggcattcgacgtggcacgggtggaatccggttttaacccttatgccatcgctgag
attgtcccgaaggccggcccctctttcggcgatcaacacattatttctcacctgccagcc
agccggggagatgcagagcatattctccgtcgcctgtcagcacaggatcgccgttactct
gtcgggctgatgcaaatcaccagcaccaatttccgccattatggtgtgtccgccacagag
ctacttgatccctgtaccaatctgtccgtcttcgaacacattctcagagactgctaccgg
cgcggcggcacgctgaaaagggcgctgagttgttattattccggcaatttcagtaccggg
caacaacctgaaacggcgttttccggaacgagctatatccagcgaatcggttatccgccg
ggatcatcccgctatgcggtccccggaacccgtgaggacaaatcatcagttgccgttccc
ctgaaaaccgcccctgccagtgactcatcccgtcaccacgtgatctggcccggagtcgtc
gtccgtggcgtccctgcgaaactccgccaagaaaaaatcttcatcgcaccgttctccgcg
ccgtcagtgcgccggagtttctccctgtcaccccgtgaggaggaggaataa

DBGET integrated database retrieval system