KEGG   Citrobacter koseri: CKO_01314Help
Entry
CKO_01314         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cko  Citrobacter koseri
Pathway
cko00040  Pentose and glucuronate interconversions
cko00052  Galactose metabolism
cko00500  Starch and sucrose metabolism
cko00520  Amino sugar and nucleotide sugar metabolism
cko01100  Metabolic pathways
cko01130  Biosynthesis of antibiotics
Module
cko_M00362  Nucleotide sugar biosynthesis, prokaryotes
cko_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CKO_01314
   00052 Galactose metabolism
    CKO_01314
   00500 Starch and sucrose metabolism
    CKO_01314
   00520 Amino sugar and nucleotide sugar metabolism
    CKO_01314
Enzymes [BR:cko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CKO_01314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABV12451
UniProt: A8AG38
Position
1282019..1282927
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGNEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGCSQIMVEPVEDVTAYGV
VDCKGAALAPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNSLGAEFKAWLEDELGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctaaattcgaaagtcaaaaaagccgttatcccggtcgcgggattaggaacc
aggatgttaccggcgacgaaagcgatcccgaaagagatgctgccgctggttgataagcca
ttaattcagtatgtcgtgaatgaatgtattgctgcgggcatcactgaaattgtgctggtg
acgcactcttccaaaaactcgatcgaaaaccatttcgataccagcttcgagctggaagct
atgctggaaaaacgtgttaagcgtcagctgctggaagaggtgcaatctatttgccctccg
cacgtaacgattatgcaggtgcgtcaggggctggcgaaaggcctgggtcatgccgtattg
tgcgcgcatcctgttgttggtaatgagcccgtcgcggtgattctgccggacgttattctg
gatgaatacgaatccgatctgtctcaggataaccttgctgaaatgattcgtcgttttgac
gaaaccggctgtagccagattatggttgagcctgttgaagatgttaccgcgtacggcgtt
gttgattgcaaaggcgcggcgctggcaccgggcgaaagcgtgccgatggttggcgttgta
gagaagccgaaagcggatgtcgcgccgtctaatctcgcggtagttggccgttatgtcctg
agcgcggacatctggcctctgctggcgaaaacccctccgggagcgggcgacgaaattcag
ctgaccgacgcgattgatatgctgatcgaaaaagaaacggtcgaagcctaccatatgaag
ggcaaaagccacgactgcggtaataaattaggttacatgcaggcgttcgttgaatatggc
atccgtcataattctctgggcgctgaatttaaagcatggcttgaagacgagttgggtatt
aagaagtaa

DBGET integrated database retrieval system