KEGG   Citrobacter koseri: CKO_01448Help
Entry
CKO_01448         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
cko  Citrobacter koseri
Pathway
cko00620  Pyruvate metabolism
cko00630  Glyoxylate and dicarboxylate metabolism
cko01100  Metabolic pathways
cko01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CKO_01448
   00630 Glyoxylate and dicarboxylate metabolism
    CKO_01448
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     CKO_01448
    1.2.1.22  lactaldehyde dehydrogenase
     CKO_01448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ABV12582
UniProt: A8AGG9
Position
1400528..1401943
Genome map
AA seq 471 aa AA seqDB search
MYINGQFVSWQGDAWIDVVNPATEELLSRIPDGGAQEARQAIDAAARAQPEWEALPAIER
AGWLRKIAAGIRERAEEISALIVAEGGKIQQLAQVEVAFTADYIEYMAEWARRYEGEILQ
SDRPGENILVFKRALGVTTGILPWNFPFFLIARKLAPALLTGNTIVIKPSEFTPNNAIAF
AQIVHDIGLPKGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVVAGEKIMAAAAKNITKV
CLELGGKAPAIVMDDADLELAVKAIVDSRVINTGQVCNCAERVYVQKGIYDRFVNRLGEA
MKAVQFGDPAQRDDIAMGPLINAAALERVEQKVARAVQEGARVALGGKAVEGKGYYYPPT
LLLDVRQEMTIIHEETFGPVLPVVAFDTLEEALEMANDSDYGLTSSVYTQNLNVAMKAIG
GLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLNEYLQTQVVYLQS
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcaatggtcaatttgttagctggcagggagacgcatggattgatgtggtgaat
cctgccaccgaagaactgctctcccgtattcctgatggcggcgcgcaagaggcgcgtcag
gccattgacgccgctgcgcgcgctcagccggaatgggaggcgctgcctgcgattgaacgc
gcggggtggctgagaaagatcgcggcagggattcgtgagcgggcagaagagatcagcgcg
ctgattgtcgcggaaggcggaaaaatccagcagctggcgcaggtggaagtcgcgttcacc
gctgactacatcgaatatatggccgagtgggcgcgccgttatgaaggcgagatcctgcaa
agcgaccgccccggagaaaatattctggtctttaaacgcgcgctgggcgtcaccaccggg
attctgccgtggaactttccgttctttttgattgcccgtaagctcgctccggcgttgttg
accgggaataccatcgtcattaaacccagcgaatttacgccaaacaatgccattgctttc
gcgcagatcgtgcatgacatcggcttaccgaaaggcgtattcaacctggtgctgggacgc
ggtgaaacagttgggcaggagctggcggggaacccgaaagtcgcgatggtaagcatgacc
ggcagcgtggtcgccggcgagaaaattatggcggcggcagcgaaaaacatcactaaagtt
tgcctggaactgggcgggaaagccccggcaatcgtgatggacgatgcggatcttgaactg
gccgtgaaagcgattgtggattccagagtgatcaacaccgggcaggtctgtaactgtgct
gagcgcgtttatgtgcaaaaagggatttacgatcgctttgtgaatcgtctgggcgaggcg
atgaaagcggttcagtttggcgatccggcacagcgtgatgacatcgcaatggggccgctg
attaacgctgccgctctggagcgggtagagcagaaagtggcgcgtgccgtacaggaaggc
gctcgcgtggcgttgggcggcaaggccgtggagggcaaaggttattattatccaccgacg
ctgctgctggatgttcgccaggagatgaccatcatacatgaggagacatttggccccgtg
ctgccggttgtggcgtttgatacgctggaagaggcgctggagatggcgaacgacagcgat
tacggtctgacatcgtctgtatatacgcaaaacctgaatgttgcgatgaaggcgatcggc
ggactgaaattcggcgagacctacatcaatcgcgaaaactttgaggcgatgcagggattc
catgctggctggcgcaagtcaggtattggcggggcggatggcaaacacggtctgaatgaa
tatctgcaaacgcaggtggtctatttgcagtcctga

DBGET integrated database retrieval system