KEGG   Citrobacter koseri: CKO_02036Help
Entry
CKO_02036         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
cko  Citrobacter koseri
Pathway
cko00260  Glycine, serine and threonine metabolism
cko00620  Pyruvate metabolism
cko00630  Glyoxylate and dicarboxylate metabolism
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CKO_02036
   00630 Glyoxylate and dicarboxylate metabolism
    CKO_02036
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKO_02036
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     CKO_02036
    1.1.1.81  hydroxypyruvate reductase
     CKO_02036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ABV13162
UniProt: A8AI49
Position
complement(1888002..1888940)
Genome map
AA seq 312 aa AA seqDB search
MEIMFYHPTFDTAWWLNALAKAIPGANIREWKPGDNEPADYALVWHPPVEMLEGRKLKAV
FALGAGVDSILSKLKAHPEMLDASIPLFRLEDTGMGLQMQEYAVSQVLHWFRRFDDYQAL
KNQSTWQPLPEYDRDEFTVGIMGAGVLGAKVAEALQAWGFPLRCWSRSRKSWPGVESFAG
AEELGAFLNQTRVLINLLPNTAETVGIINSGLLNQLRDGAYLLNLARGVHVNEDDLLAAL
NSEKLKGAMLDVFSREPLPKESPLWQHPRVAMTPHIAAVTRPAEAVDYISRTITHLERGE
SVTGQVDRVRGY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggagataatgttctatcacccgaccttcgatacggcctggtggcttaacgctttggca
aaggcgattcccggcgcgaatattcgtgaatggaaacccggtgataacgaacctgcggat
tatgcgctcgtgtggcatccgccggtggagatgcttgaaggacggaagctaaaagccgta
tttgcgcttggcgcaggtgtggattccattctgagtaagctcaaagcgcacccggaaatg
ctggatgcctctatcccgctgttccgcctggaagataccggcatgggcctgcaaatgcag
gagtatgccgtgagccaggtgctgcattggttccgccgtttcgatgattatcaggcgctg
aaaaaccagtcaacatggcagccgctgccggaatatgatcgcgatgagttcaccgtcggt
attatgggggcaggggtgctgggcgccaaagtcgctgaagcgctccaggcatggggattc
ccgcttcgctgctggagccgtagccgtaaatcctggcctggcgtagagagttttgcggga
gctgaggagttaggcgcattcctgaatcaaacaagggtgctgatcaacctgctgccaaat
acggcggagacggtgggcattattaattccggcttgctcaatcagttacgggatggcgct
tacctgcttaacctggcgcgtggcgtgcatgttaatgaggacgatctgcttgccgcgttg
aatagcgaaaaactcaaaggggcgatgctggatgttttcagccgcgagccgctgccaaaa
gagagtccgctctggcaacaccctcgcgtggcgatgacgccgcacattgccgccgtcacc
cgcccggcggaagccgtggactatatttcgcgcaccattacgcatctggaacgcggcgaa
tccgtgacgggtcaggtcgatcgcgttcgcggctactga

DBGET integrated database retrieval system