KEGG   Citrobacter koseri: CKO_02487Help
Entry
CKO_02487         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cko  Citrobacter koseri
Pathway
cko00520  Amino sugar and nucleotide sugar metabolism
cko01100  Metabolic pathways
cko01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CKO_02487
Enzymes [BR:cko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     CKO_02487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ABV13604
UniProt: A8AJE1
Position
2302074..2303222
Genome map
AA seq 382 aa AA seqDB search
MYALTQGRIFTGHEILDDHAIVVANGLIDRICPVAELPPEIEQRALNGAILSPGFIDVQL
NGCGGVQFNDTADAVTVETLEIMQKANEKSGCTSYLPTLITTSDDLMKQGIRVMREYLAK
YPNQALGLHLEGPWLNLVKKGTHNPSFVRQPDAALVDFLCDNADVITKVTLAPEMVPAEV
IAKLTAAGIVVSAGHSNATLKEAKAGFRAGITFATHLFNAMPYITGREPGLAGAILDDAD
IYCGIIADGLHVDYVNIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCV
DENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVDKQLGSLAPGKVANL
TAFTHDFKIIKTIVNGNEVVTE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtatgctttaacccagggccggatttttaccggtcacgaaattcttgatgaccatgcg
attgttgtcgccaatggcctgattgatcgcatctgtccagtggcggaactgccgccagag
atagaacaacgcgcgttgaatggggccattctctcccccggttttattgatgtgcaatta
aacggctgcggcggcgtccagttcaacgataccgctgacgcggtgactgtcgaaacgctg
gaaatcatgcagaaagccaatgagaaatcaggctgcaccagctacctgccgacgctgatt
accaccagcgacgatctgatgaaacagggcattcgcgtcatgcgtgaatacctggcgaaa
tacccgaatcaggcattaggtcttcatcttgaaggtccgtggctgaacctggtcaaaaaa
ggcacccataatccgagttttgtccgccaacctgacgctgcgctggtggacttcctgtgc
gataatgccgatgtgatcaccaaagtcacgctggcgccggaaatggtgccggcggaagtg
atcgccaaactgacggcggcgggcattgtggtttcagccggtcactccaacgcgacgtta
aaagaggcgaaagccggtttccgcgcagggatcacctttgccacccacctgttcaacgcg
atgccgtatattacgggccgtgaaccgggtctggcgggcgccattcttgacgatgccgat
atttattgcggcatcatcgcggatggtctgcatgttgattacgtcaacattcgtaacgct
aaacgtctgaaaggtgacaaactttgcctggtgaccgatgcaaccgccccggcgggtgca
aacattgaacagttcatttttgctggtaaaacaatatactaccgtaatggactgtgtgtg
gatgagaacggtacgctgagcggatcatcattaaccatgatcgaaggcgtgcgtaatctg
gttgaacattgcggtattgcgctggatgaagtgctgcgtatggcgacgctctaccctgcg
cgcgcgattggcgtcgataagcagctcggcagcctcgcgccgggtaaagttgcgaacctg
accgccttcacccacgactttaaaatcatcaagaccatcgttaatggtaacgaggtcgtt
actgagtaa

DBGET integrated database retrieval system