KEGG   Citrobacter koseri: CKO_02519Help
Entry
CKO_02519         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
cko  Citrobacter koseri
Pathway
cko00860  Porphyrin and chlorophyll metabolism
cko01100  Metabolic pathways
Module
cko_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CKO_02519
Enzymes [BR:cko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     CKO_02519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABV13628
UniProt: A8AJG5
Position
2326679..2327290
Genome map
AA seq 203 aa AA seqDB search
MRLWLVRHGETEANVAGLYSGHAPTPLTEKGIAQAQTLNNLLRNVPFDNVFCSELERARH
TARLVLHDRDVPQRLFPELNEMFFGDWEMRHHRDLSREDAASYTAWCTDWQNAVPTNGEG
FQAFSQRVERFIAQLADYKDNKNLLVVSHQGVLSLMIARLLSMPAASLWHFRVEQGCWSA
IDFCEDFATLKVLNSRAVWHHGE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgactctggttagttcgtcatggggaaaccgaagctaatgtagccggattatacagc
ggccacgcccccactccgctgacagaaaaagggatagcccaggcgcaaacgctgaataac
ctgctgcgcaatgtccccttcgacaacgtattctgtagcgaactggaacgcgcccgccac
acggcgcggctggtgcttcacgaccgcgacgtaccgcagcgcctgttcccggagcttaac
gagatgttttttggcgactgggagatgcgtcatcaccgcgatctgagccgcgaagacgcg
gcaagctacacggcctggtgtaccgactggcagaacgccgtcccgaccaatggggaaggc
ttccaggcgttctcacaacgagtagagcgttttattgcacaacttgctgattataaagat
aataaaaacctgctggtcgtgagccaccagggggttctgagtctcatgatcgcgcgatta
ttatccatgcccgccgcctcattatggcatttcagggttgagcaaggatgctggagcgcc
attgatttttgtgaagatttcgccacgctgaaggtgttaaacagtcgggccgtctggcat
cacggcgagtga

DBGET integrated database retrieval system