KEGG   Citrobacter koseri: CKO_02944Help
Entry
CKO_02944         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cko  Citrobacter koseri
Pathway
cko00052  Galactose metabolism
cko00500  Starch and sucrose metabolism
cko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CKO_02944
   00500 Starch and sucrose metabolism
    CKO_02944
Enzymes [BR:cko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CKO_02944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: ABV14050
UniProt: A8AKN7
Position
complement(2726906..2728312)
Genome map
AA seq 468 aa AA seqDB search
MTLASRWPAVLQAVMQGQPCALADSHYPQWHPAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LGCDHRYKCWGHWSSVDLVHWQHESIALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGGRIAWQCLAVQNDDGSFTKQGPVLPLPEGYTGHVRDPKVWCHDGQWYMVLGAQDLQ
KQGKVLLFTSDDLHHWQPCGEIAGQGVNGLTDSGYMWECPDLFALDETHVLICCPQGLAR
EPHRYLNTYPSVWMSGAFDYETASFAHGELHELDAGFEFYAPQTTVAEDGRRILIGWMGV
PDGEEMLQPTCAYGWIHQMTCPRELKYRDGRLWQTPARELEQLREAEHQWQGRASDAPEL
EATRLEFELSTSYVNADFAGALRLTVDDYGVRLERASLKNGEMLTRYWQGDVSHLRVLCD
SSSIEIFINHGEGVMSSRYFPDHPARVRFEGASDITLRYWSLRRCMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgactttagcttcccgctggcctgccgtgttgcaggcagtaatgcaaggccagccgtgt
gcactggcggacagccattatccgcagtggcatcccgcgccggtaacggggctgatgaac
gatccgaacgggtttatctggtttgccgggcgctaccacctgttttatcaatggaaccca
ctgggctgcgatcatcgctataagtgctggggacactggagctccgtggatctggtgcac
tggcagcacgagtcaattgccctgatgcccgacgaagagtatgaccgtaacggctgttac
tccggcagcgccgtggataacaacggcgtgctgaccctgtgctacaccggtaacgtcaag
tttgacgacggcggtcgcatcgcctggcagtgtctggcggtgcaaaatgatgatggcagt
tttaccaagcaggggccagtgttgcccctgccggaagggtacaccgggcatgtacgggac
ccgaaggtgtggtgccatgatgggcagtggtacatggtgctcggtgcgcaggatctgcaa
aagcagggcaaagtgctgctgttcacatccgatgatttacaccactggcagccctgcggt
gagattgctggacagggcgtgaacggtcttacggactccgggtatatgtgggagtgtccg
gatctgtttgcgcttgatgaaacacatgtgttgatctgctgcccgcaggggctggcgcgc
gaaccgcatcgctatctcaatacctatccgtcagtctggatgagcggggcatttgattat
gaaacggcttcgtttgcccacggcgagctgcatgagcttgacgccggttttgagttttat
gcgccacaaaccacggtggcggaagacggaagacgcatcctgatcggctggatgggcgtg
ccggacggtgaagagatgcttcagcccacatgtgcgtacggctggatccaccagatgacc
tgcccgcgggaattgaagtatcgcgacggcaggctctggcaaacgcctgccagagaactt
gaacagcttcgcgaagccgaacaccagtggcagggccgcgccagcgatgcgccagaactg
gaggcgacgcgtcttgagtttgaactgagcacttcgtacgtgaatgccgattttgccggc
gcgttgcgtctcacggtcgatgactacggtgtgcgtctggaacgcgccagtctgaaaaac
ggtgaaatgttgacccgctactggcagggcgacgtcagccatttacgcgttctgtgcgac
agctccagtattgaaattttcatcaaccatggcgaaggggtgatgagcagccgctatttt
cctgaccatccggcccgggtacgcttcgaaggtgcgtccgacatcacattacgctactgg
tcgctgcgccgctgcatgatagaatag

DBGET integrated database retrieval system