KEGG   Citrobacter koseri: CKO_02990Help
Entry
CKO_02990         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
cko  Citrobacter koseri
Pathway
cko00760  Nicotinate and nicotinamide metabolism
cko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CKO_02990
Enzymes [BR:cko01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     CKO_02990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX zf-NADH-PPase DZR zinc_ribbon_2 C1_1 OrfB_Zn_ribbon
Motif
Other DBs
NCBI-ProteinID: ABV14090
UniProt: A8AKS7
Position
complement(2769890..2770663)
Genome map
AA seq 257 aa AA seqDB search
MDRIIEKLDHGWWIVSHEQKLWLPRGELPYGEATNFDLVGQRALLIGEWEGEPVWLVLQH
RRHDMGSVRQVIDQDVGLFQLAGRGVQLAEFYRSHKFCGYCGHPMYPSKTEWAMLCSHCR
ERYYPQIAPCIIVAIRRADSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESG
IKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGEIVIDPKELLEAGWYRYDDLPLLPPPGTV
ARRLIEDTVAMCRAEYE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtattattgaaaaattagatcacggttggtggatcgtcagtcacgagcaaaaa
ttatggttgcctcgtggagaattgccatatggcgaagcgacaaatttcgatcttgtgggg
cagcgcgcactcctgattggcgagtgggaaggagagcctgtctggctggtgttacagcat
cgtcggcatgatatggggtcggtacggcaggtcatcgatcaggacgttggcctgtttcaa
ctggcggggcggggcgtgcagctggcggaattttatcgctcgcacaaattctgcggttac
tgcggccaccccatgtacccgagcaagaccgaatgggcgatgctgtgcagccactgccgc
gagcgttactatccgcagattgctccctgcattattgtcgccatccggcgtgccgattcc
attttactggcccagcatacgcgccatcgtaacggtgttcatacggtgctggccgggttt
gtggaagtgggggagaccttagagcaggcggttgcgcgcgaagtgatggaagagagcggc
atcaaagtgaaaaatctgcgttacgtgacctcacagccctggccgttcccgcaatcgctg
atgacggcgtttatggcggagtatgacagcggcgagattgtcatcgacccgaaagagctg
ctggaggcgggctggtatcgctatgacgatcttccgttattgccgccgccgggcacggtg
gcgcgtcgtttgatcgaagatactgtggcaatgtgtcgggctgagtatgagtga

DBGET integrated database retrieval system