KEGG   Citrobacter koseri: CKO_03258Help
Entry
CKO_03258         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cko  Citrobacter koseri
Pathway
cko00010  Glycolysis / Gluconeogenesis
cko00020  Citrate cycle (TCA cycle)
cko00620  Pyruvate metabolism
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
cko01130  Biosynthesis of antibiotics
cko01200  Carbon metabolism
Module
cko_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKO_03258
   00020 Citrate cycle (TCA cycle)
    CKO_03258
   00620 Pyruvate metabolism
    CKO_03258
Enzymes [BR:cko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CKO_03258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3 DUF1223
Motif
Other DBs
NCBI-ProteinID: ABV14342
UniProt: A8ALH8
Position
complement(3024152..3026044)
Genome map
AA seq 630 aa AA seqDB search
MAIEINVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTATGALIMIFDSADGAADAAPAPAEEKKEAAPAAAPAAAAAKDVHVPDIGGDEVEV
TEILVKVGDTVAAEQSLITVEGDKASMEVPAPFAGTVKEIKVNAGDKVSTGSLIMVFEVA
GAAPAAAPAQAAAPAAAAPAAAAGAKDVNVPDIGGDEVEVTEVMVKVGDKVEAEQSLITV
EGDKASMEVPAPFAGVVKELKVNVGDKVSTGSLIMVFEVEGAAPAAAPAAAAPAPAAAPA
QAAKPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDV
QAYVKDAIKRAESAPAGATGGSLPGLLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNW
VMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFTPVVFIMKAVAAALEQMPRFNSS
LSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELTTISKKARDGKLTA
GEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFTPRLMMPISLS
FDHRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaacgtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagttgaagctgaacagtcgctgatcaccgtagaaggcgac
aaggcctctatggaagttccatcgccgcaggcgggcgtcgttaaagagattaaagtctct
gttggcgacaaaaccgcgacgggcgcacttatcatgattttcgattccgccgacggtgca
gctgacgctgcgcctgctccggcagaagagaagaaagaagccgctccggcagccgctcct
gctgctgcggcagcgaaagacgtacacgtaccagatatcggcggcgacgaagttgaagtc
accgagatcctggtcaaagtgggcgacaccgttgcggctgagcagtcgctgatcaccgta
gaaggcgacaaagcttctatggaagtgccggcgccgttcgcgggtacggttaaagagatc
aaagtcaacgctggcgataaagtgtctaccggctctctgatcatggtcttcgaagtggcg
ggcgctgcgcctgctgctgcgcccgctcaggcggcagcaccagcagcggcggctccggca
gcagcggctggcgcgaaagacgttaacgtaccggacatcggcggcgacgaagttgaagtc
accgaagtgatggttaaagtcggcgataaagttgaagccgaacagtcgctgatcaccgta
gaaggcgacaaagcctctatggaagtgccggcgccgttcgcgggcgtggttaaagagctg
aaagttaacgttggcgacaaagtgtctaccggctctctgattatggtcttcgaagtggaa
ggcgctgcccctgccgcggctccggctgctgctgctccggcacctgccgctgcacctgct
caggccgctaaaccggctgctgcgcctgcggcaaaagcggaaggcaaatctgagtttgct
gaaaatgacgcttacgttcacgcgaccccgctgattcgccgcctggcgcgcgagttcggc
gttaacctggcgaaagtgaagggtactggccgtaaaggtcgtatcctgcgcgaagacgtt
caggcttacgtgaaagacgctatcaagcgcgctgaatccgcgccagcgggcgcaaccggc
ggttctctgccaggtcttctgccgtggccgaaagtggacttcagcaagtttggtgaagtg
gaagaagttgaactgggccgcatccagaaaatctctggtgctaacctgagccgtaactgg
gtgatgatcccgcacgttacgcacttcgacaaaacggatatcaccgatctggaagcgttc
cgtaagcagcagaatgcggaagctgaaaaacgtaagctggacgtgaaattcacgccagtg
gtcttcatcatgaaagccgttgccgctgctctggaacagatgccgcgcttcaacagctct
ctgtctgaagacggtcagcgcctgacgttgaagaagtacatcaacattggtgtcgcggtc
gacacgccgaacggtctggttgttccggtgttcaaagatgtgaacaagaagagcattact
gagctgtcccgtgaactgacgaccatctctaagaaagcgcgtgatggtaagctgaccgct
ggcgaaatgcagggcggttgcttcactatctccagcatcggcggcctgggcaccacccac
ttcgcgccgattgtgaacgcgccggaagtggctatcctcggcgtttctaagtccgcaatg
gaaccggtgtggaatggtaaagagtttactccgcgtctgatgatgccgatttctctctcc
ttcgaccaccgcgtgattgacggtgctgatggtgctcgctttatcaccatcatcaacaac
acgctgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system