KEGG   Citrobacter koseri: CKO_03330Help
Entry
CKO_03330         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
cko  Citrobacter koseri
Brite
KEGG Orthology (KO) [BR:cko00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CKO_03330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ABV14413
UniProt: A8ALQ0
Position
3101514..3101891
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGEGVVGVQPHIAPGEEYQYTSGAVIETPLGTMQGHYEMIDEKGVAFTIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgccccgagtgtgtattcaggttcagagcgtctacattgaagcgcaatct
tcacctgatgatgaacgttacgtattcgcatacacggtaaccatccgcaatttggggcga
gcgccagtgcagttgttggggcgttattggctgataaccaatggtcatggccgcgaaacc
gaagtacagggcgaaggtgtggttggcgtacagccgcacatcgcgcccggagaagagtac
cagtacaccagcggcgccgttattgaaacgccgctgggcaccatgcagggtcactacgaa
atgatcgatgaaaaaggcgtcgcctttactatcgatattcccgtgttccgactcgccgtt
ccaacacttattcattaa

DBGET integrated database retrieval system