KEGG   Citrobacter koseri: CKO_03383Help
Entry
CKO_03383         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cko  Citrobacter koseri
Pathway
cko00260  Glycine, serine and threonine metabolism
cko00750  Vitamin B6 metabolism
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
cko01230  Biosynthesis of amino acids
Module
cko_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKO_03383
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CKO_03383
Enzymes [BR:cko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CKO_03383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABV14466
UniProt: A8ALV3
Position
complement(3152296..3153582)
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEVDEMLNQDFVSRSAKILS
AFIGDEIPQEILEERVREAFAFPAPVRQVEGDVGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKAALGLNSANSINISRLLAQICYYFEAVAQLQQDARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLKEGQWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDETTQETMRELKAAGYTSEPHAAVAYRA
LRDQLHPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELADRADLPLLSHNLPADFAEL
RKLMMTRG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatctgaaagatcataatgagcaggtcagctttgcgcaggccgttacg
caggggcttggcaagaatcaggggctctttttcccgcacgacctgccggaatttagcctg
actgaagttgatgagatgctgaatcaggactttgtgagtcgtagcgcaaagatcctttcc
gcgtttatcggggatgagatcccgcaggaaatcttagaagagcgcgtccgcgaggcattc
gcttttccggcgccggtgcgtcaggtggaaggcgatgtcgggtgcctggagttgttccac
ggcccgacgctggcctttaaggattttggcggtcgctttatggcgcaaatgctgacgcac
atcagcggcgacaaaccggtgactatcctgacggcgacctctggcgataccggcgcggca
gttgctcacgcattctacggtctgaaaaatgtacgcgtcgtgatcctctacccacgcggc
aagatcagcccgttgcaggaaaaactgttctgtacgctgggcggcaacatcgaaacggtt
gcgattgacggtgatttcgatgcctgccaggcgctggtaaaacaggcgtttgatgatgaa
gaactgaaggcggcgctggggctgaattcggcgaactccatcaacatcagccgtctgctg
gcgcagatttgctattactttgaagcggtcgctcaactgcagcaggacgcgcgtaatcag
ttagtgatctccgtgcccagcggtaactttggcgacctgacggcggggctgctggcgaag
tcgctcggcctgccggtgaaacgctttatcgccgccactaacgtcaacgatacggtgccg
cgcttcctgaaagaggggcagtggtcgccgaaagcgacgcaggctaccttgtcgaacgcg
atggatgtcagccagcccaataactggccgcgcgtggaagagctgttccgccgtaaaatc
tggcgtctgacggagctgggctacgctgcggttgacgatgagacgacgcaggagaccatg
cgcgaactgaaagcggcaggttatacctctgaaccgcacgctgccgtggcgtaccgcgcg
ctgcgtgatcaactgcacccgggggagtatggcttgttcctcgggactgcgcatccggcg
aaattcaaagagagtgtggaggcgattcttggtgaaacattggatctgccaaaagagctg
gcggatcgtgccgatctgccgctgctctcgcataatctgcctgccgattttgccgaattg
cgtaagctgatgatgacacgcggctaa

DBGET integrated database retrieval system