KEGG   Citrobacter koseri: CKO_03851Help
Entry
CKO_03851         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cko  Citrobacter koseri
Pathway
cko00020  Citrate cycle (TCA cycle)
cko00640  Propanoate metabolism
cko00660  C5-Branched dibasic acid metabolism
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
cko01130  Biosynthesis of antibiotics
cko01200  Carbon metabolism
Module
cko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cko_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKO_03851
   00640 Propanoate metabolism
    CKO_03851
   00660 C5-Branched dibasic acid metabolism
    CKO_03851
Enzymes [BR:cko01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CKO_03851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABV14927
UniProt: A8AN64
Position
complement(3582495..3583664)
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKSLLAGMGMPCPKEIAIQHITELPEAWRTISSENKGAVLKAQVHAGGRGKAG
GVKVLTQFSQAETFAVQMLGSQLVTYQTGSEGQYVSRILVCENIYPVRQELYFGVVVDRE
SQRVTFIVSSEGGVEIEKVAHDTPEKIDKVSVDPLTGIQPCHVRELFAVLGLEKTLYSGF
SQLVNQAWKAFNELDFALLEINPLVICENGEFMCADAKVTLDDNALYRHPELQALRDETQ
EDERENQAAKLDLNYVALDGAIGCMVNGAGLAMATMDIIKLYGAQPANFLDVGGGATQER
VSEAFRLIVSDKKVQGILVNIFGGIVRCDMIARAIIHALHEEQITLPVVVRLSGNHATEG
QRLLAESGLAVEAVDSLDDAAKRIIALLK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgagtatcaggctaaatcattactggccggtatgggtatgccatgcccg
aaagagatagcgattcaacatattactgagttgccggaagcctggcgcactatttccagt
gaaaacaaaggcgcggtgctgaaagcccaggtacatgctggtggacgtgggaaagctggc
ggcgtgaaggtgctcacgcagttttcgcaggcggaaacgttcgccgtacagatgctgggt
tcgcaactggtgacctaccagaccgggtcggaaggtcagtatgtcagccgcattctggtg
tgcgaaaacatctatccggtacgtcaggaactctattttggcgtagtggttgatcgcgaa
agccagcgcgtcacgtttattgtcagttctgaaggcggtgtggagattgaaaaggtcgca
catgacacgccggaaaagatcgataaagtgagcgtcgatccgcttactggcattcagcct
tgccatgtgcgtgagttgtttgcggtgctgggactggagaaaacgttgtattccgggttc
agccaattggtgaatcaggcatggaaggcgtttaacgaactcgattttgcgctgctggag
attaatccgctggtgatctgtgaaaatggcgagtttatgtgcgccgacgcaaaagttacc
ctggatgataacgcattgtatcgtcaccctgaattacaggcgttacgcgatgaaacgcag
gaagatgagcgggaaaaccaggcggcgaaactcgaccttaactatgttgcgttggatggc
gctatcggctgtatggttaatggtgccgggctggcgatggcgacaatggacattataaaa
ctctatggcgcgcaacccgccaactttcttgacgttggtggtggtgcgacgcaggaacgg
gtcagtgaagcatttcgcctgattgtctccgataaaaaagtacagggaattctggtcaat
attttcggcggcatcgtgcgttgcgacatgattgctcgcgccattatccacgcgctgcat
gaagaacaaattaccctgccggtagtggtgcgtctgtccggcaaccatgcgactgaaggg
cagcgtttgttggcggaaagtggtctcgcggtagaagccgttgattctctcgatgatgcc
gcgaagcgcatcatcgcattgctgaaatga

DBGET integrated database retrieval system