KEGG   Citrobacter koseri: CKO_04098Help
Entry
CKO_04098         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
cko  Citrobacter koseri
Pathway
cko00130  Ubiquinone and other terpenoid-quinone biosynthesis
cko00627  Aminobenzoate degradation
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
cko01220  Degradation of aromatic compounds
Module
cko_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CKO_04098
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CKO_04098
Enzymes [BR:cko01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     CKO_04098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ABV15164
UniProt: A8ANV1
Position
complement(3811255..3811848)
Genome map
AA seq 197 aa AA seqDB search
MRLIVGMTGATGAPLGIALLQALRQMPTVETHLVMSKWAKTTIELETPYSARDVAGLADY
CHNPADQAATISSGSFRTDGMIIMPCSMKTLAGIRAGYAEGLVGRAADVVLKEGRKLVLV
PREMPLSTIHLENMLALSRMGVAMVPPMPAFYNHPQTIDDITQHIVARVLDQFGLEHPRA
RRWQGLQQAQNFSQENE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagactgattgtggggatgaccggcgcaacgggggcgccgctaggcattgcgctgcta
caggcgctgcggcaaatgccgacagtagaaacacacctggtaatgtctaagtgggccaaa
acgaccattgagctggaaacgccttacagtgcgcgagatgttgccggactggctgattac
tgccataacccggcggatcaggcggcgacgatctcttccggctcatttcgcaccgacggc
atgatcattatgccttgcagtatgaaaacgctggcggggattcgcgcaggatatgccgag
gggttagttggccgtgccgccgatgtggtgctgaaagaagggcgcaaactggtgctggtg
ccgcgtgaaatgccgctcagcacgatccatctggaaaacatgctcgccctttcccgcatg
ggggtcgcgatggtgccgcccatgcctgctttctacaaccatccgcaaactattgatgat
attacgcagcatattgtggcgcgtgtgctggatcagtttggtctggagcatccgcgtgcc
cggcgctggcaggggttgcagcaggcgcagaatttttcacaggagaatgaataa

DBGET integrated database retrieval system