KEGG   Citrobacter koseri: CKO_04222Help
Entry
CKO_04222         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cko  Citrobacter koseri
Pathway
cko00071  Fatty acid degradation
cko00280  Valine, leucine and isoleucine degradation
cko00310  Lysine degradation
cko00362  Benzoate degradation
cko00380  Tryptophan metabolism
cko00620  Pyruvate metabolism
cko00630  Glyoxylate and dicarboxylate metabolism
cko00640  Propanoate metabolism
cko00650  Butanoate metabolism
cko00900  Terpenoid backbone biosynthesis
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01120  Microbial metabolism in diverse environments
cko01130  Biosynthesis of antibiotics
cko01200  Carbon metabolism
cko01212  Fatty acid metabolism
cko02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CKO_04222
   00630 Glyoxylate and dicarboxylate metabolism
    CKO_04222
   00640 Propanoate metabolism
    CKO_04222
   00650 Butanoate metabolism
    CKO_04222
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CKO_04222
   00072 Synthesis and degradation of ketone bodies
    CKO_04222
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CKO_04222
   00310 Lysine degradation
    CKO_04222
   00380 Tryptophan metabolism
    CKO_04222
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CKO_04222
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CKO_04222
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CKO_04222
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cko04147]
    CKO_04222
Enzymes [BR:cko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CKO_04222
Exosome [BR:cko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKO_04222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: ABV15281
UniProt: A8AP68
Position
complement(3920068..3921246)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLSRHSAVELGSMVVKALMERTGVDVHAIDEVILGQVLTAG
AGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGAQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDAGRFKAEIVPVVTQRNGQPVVVDTDEQPRTDASAEGLAQLNPAFDLLGS
VTAGNASSINDGAAAVMMMSEAKAQELDLPILARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALAIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagttggggctttacgtacgccgatcggatgcttccagggaacg
ctgtcccgccattctgccgttgaactgggcagcatggtggtaaaagcgttgatggagcgt
accggcgttgatgtacatgctatcgatgaagttatcctcggtcaggtgctcacggcgggc
gcaggacaaaacccggcgcggcagtcagccatcaaaggtgggctgcccaacaccgtttcc
gctatcaccatcaacgatgtctgcggctccggcctgaaagcgctgcacctggctacacag
gcgattcagtgcggcgaggcggatattgtcattgccggcgcgcaggagaacatgagccgg
gcgccgcacgttcttaccgacagccgcacaggggcgcagctcggtaacagccaactggtg
gacagcctggttcacgacggcttgtgggatgcgtttaacgattaccacatgggcgttacc
gctgaaaatctggcgcgggaatacggcatcagccgcgaattgcaggacgcctatgccctc
agttcccagcaaaaagcgcgggcggccattgatgccgggcgttttaaagctgagattgtc
ccggttgtcacccagcgtaacggccagcctgtcgttgtcgatactgatgagcagccaaga
accgatgccagcgcggaaggattggcccagttgaacccggcatttgatctcctcggctcg
gtcacggcgggcaatgcctcgtcaattaacgatggcgcggctgccgtcatgatgatgagc
gaagccaaagcgcaggaactggatttacccatactggcgcgtattcgcgcttttgccagc
gtcggcgtcgatcccgcactgatgggcatcgcacccgtttacgccacccgacgttgtctt
gaacgggtaggctggcagctggcggacgtggatcttatcgaggctaacgaggcttttgct
gcgcaggcgttatccgtcggcaaaatgctggagtgggacgaacgccgggtgaacgttaac
ggcggagcgattgcgctcggtcatcccattggcgcatccggctgccggattctggtgtcg
ctggtgcatgagatggttaaacgcaatgcgcgaaagggcctggcgacgctctgcattggc
ggcgggcaaggcgtggcgcttgctatcgaacgagattaa

DBGET integrated database retrieval system