KEGG   Citrobacter koseri: CKO_04574Help
Entry
CKO_04574         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
cko  Citrobacter koseri
Pathway
cko00220  Arginine biosynthesis
cko00250  Alanine, aspartate and glutamate metabolism
cko01100  Metabolic pathways
cko01110  Biosynthesis of secondary metabolites
cko01130  Biosynthesis of antibiotics
cko01230  Biosynthesis of amino acids
Module
cko_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CKO_04574
   00220 Arginine biosynthesis
    CKO_04574
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cko04147]
    CKO_04574
Enzymes [BR:cko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     CKO_04574
Exosome [BR:cko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKO_04574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC
Motif
Other DBs
NCBI-ProteinID: ABV15626
UniProt: A8AQ63
Position
4223907..4225250
Genome map
AA seq 447 aa AA seqDB search
MTTILKHLPVGQRIGIAFSGGLDTSAALLWMRQKGAVPYAYTANLGQPDEDDYDAIPRRA
MEYGAENARLIDCRKQLVAEGIAAIQCGAFHNTTGGLTYFNTTPLGRAVTGTMLVAAMKE
DGVNIWGDGSTYKGNDIERFYRYGLLTNAELQIYKPWLDTDFIDELGGRHEMSEFMIACG
FDYKMSVEKAYSTDSNMLGATHEAKDLEFLNSSVKIVNPIMGVKFWDENVKIPAEEVTVR
FEQGHPVALNGKTFSDDVELMLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALL
HIAYERLLTGIHNEDTIEQYHAHGRQLGRLLYQGRWFDSQALMLRDGLQRWVASQITGEV
TLELRRGNDYSILNTVSDNLTYKPERLTMEKGDSVFSPDDRIGQLTMRNLDITDTREKLF
GYAQSGLLSASSATGLPQVENLENKGK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgattctcaagcatcttccggtaggtcaacgtattggtatcgctttttccggc
ggcctggacaccagtgctgcactgctgtggatgcgacaaaaaggcgctgtcccttatgca
tatactgcgaatctgggccagccagatgaggatgactatgacgccattcctcgtcgcgca
atggaatacggcgcagagaacgctcgcctgattgattgccgtaaacagctggttgccgaa
gggatcgccgcgattcagtgcggtgctttccataacaccaccggcggactgacctatttc
aacaccacgccgctgggccgcgccgttaccggcacgatgctggtcgctgcgatgaaggaa
gatggtgttaacatctggggcgacggcagtacctataaaggaaacgacatcgagcgtttc
taccgttacggcctgttgaccaacgcggagctacagatttacaaaccgtggctggatacc
gactttattgatgagctgggcggtcgtcatgagatgtccgagtttatgattgcctgcggt
ttcgactacaagatgtccgtcgaaaaagcctattccactgattccaacatgctcggcgcg
acccatgaagccaaagatctggaattcctgaactccagcgtcaagatcgtcaatccaatc
atgggcgtcaagttctgggatgaaaacgtgaaaatcccggcggaagaagttaccgtgcgc
tttgaacaggggcatcctgtcgcgctaaacggtaagaccttcagcgatgatgttgaactg
atgctggaagctaaccgtatcggcggccgccacggtctgggcatgagcgatcagattgag
aaccgtatcattgaagcgaagagccggggtatctatgaagcgccggggatggcgctgctg
catattgcctacgagcgtctgctgaccggcatccacaacgaagacactatcgagcagtat
catgcgcatggccgtcagttaggccgcctgctgtatcagggccgctggtttgactcccag
gcgctgatgctgcgtgacggtctgcaacgttgggtggccagccagattaccggtgaagtc
acgctggagctgcgtcgtggtaacgactactcgatcctgaataccgtctctgacaatctg
acctacaaaccagagcgtctgacgatggaaaaaggagactccgtgttctcgccggatgac
cgtatcggtcagttgacgatgcgcaacctggatatcaccgatacgcgtgaaaaactgttt
ggttatgcgcagtcaggcctgctttccgcctcttccgcgacaggtttgccgcaggttgaa
aatctggaaaacaaaggcaagtaa

DBGET integrated database retrieval system