KEGG   Citrobacter koseri: CKO_04578Help
Entry
CKO_04578         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
cko  Citrobacter koseri
Pathway
cko00790  Folate biosynthesis
cko01100  Metabolic pathways
Module
cko_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CKO_04578
Enzymes [BR:cko01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CKO_04578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABV15629
UniProt: A8AQ66
Position
complement(4227442..4228290)
Genome map
AA seq 282 aa AA seqDB search
MKLFAQGSTLDLSHPHVMGILNVTPDSFSDGGTHNTLVEAVKHANLMINAGATIIDVGGE
STRPGAADVSVEEELERVIPVVESIAQRFEVWISVDTSKPEVIRESARVGAHIINDIRSL
SEPGALEAAAETGLPVCLMHMQGQPKTMQEAPKYEDVFAEVNRYFIDQIARCERAGIVKE
KLLLDPGFGFGKNLSHNYTLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVGPSDRLSGSL
ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttcgcccagggctccacgctggatctctctcacccacacgtaatgggcatc
ctgaacgtcacgccggattctttctccgatggcgggacgcacaatacgctggtggaggcg
gtgaagcacgctaatctgatgattaacgccggagcgacgattattgatgtcggcggcgaa
tcaacgcgacctggcgcggcggatgtcagcgttgaagaagaactggaacgcgtgatcccg
gtagttgagtccatcgcccagcgttttgaggtatggatttcagtggatacctcaaaaccg
gaggtgattcgggaatcggcaagagtgggcgctcacatcatcaacgacattcgctccctc
tctgaaccgggcgcgcttgaggcggcggctgagactggtttaccggtctgcctgatgcat
atgcaagggcagcctaaaacaatgcaggaagcgccaaagtacgaagacgtttttgcggag
gtcaatcgctactttattgaccaaatagcacgctgtgaaagggctggcatcgtaaaagag
aaattgttgctcgacccgggattcggtttcggtaaaaatctctcccataactatacgtta
ctggcacgtctggcggagtttcatcattttaacctgccgctgctggtgggaatgtcacgt
aaatcgatgattggtcagttgctcaacgtcgggccctccgatcgtttgagcgggagcctg
gcgtgtgcggttatcgccgcaatgcagggggcgcatatcattcgtgtccatgacgttaaa
gaaaccgtagaagcgatgcgtgtggtagaagccaccctgtctgcaaaggaaaataaacgc
tatgagtaa

DBGET integrated database retrieval system