KEGG   Corynebacterium kroppenstedtii: ckrop_0253Help
Entry
ckrop_0253        CDS       T00896                                 

Gene name
pck
Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00010  Glycolysis / Gluconeogenesis
ckp00020  Citrate cycle (TCA cycle)
ckp00620  Pyruvate metabolism
ckp01100  Metabolic pathways
ckp01110  Biosynthesis of secondary metabolites
ckp01120  Microbial metabolism in diverse environments
ckp01130  Biosynthesis of antibiotics
Module
ckp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ckp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ckrop_0253 (pck)
   00020 Citrate cycle (TCA cycle)
    ckrop_0253 (pck)
   00620 Pyruvate metabolism
    ckrop_0253 (pck)
Enzymes [BR:ckp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     ckrop_0253 (pck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_C PEPCK_N
Motif
Other DBs
NCBI-ProteinID: ACR17040
UniProt: C4LGT5
Position
312426..314291
Genome map
AA seq 621 aa AA seqDB search
MSAPTIPGLEGNAPTTNQDMLNWIAECAELCQPDKVVFCDGSDEEWEAIAKDLVEKGTLI
KLNEEKRPNSYLASSDPADVARVESRTFICSKTEDGAGPTNNWRDPDEMRAEMSEHFKGS
MKGRTMYVVPFCMGPITDPDPKLGIELTDSGYVVMSMRIMTRMGKEALDKIGDGPFVKGL
HSVGAPLEPGQEDVKWPCNETKYITQFPEDRVIWSYGSGYGGNAILAKKCYALRIASVMA
KDEGWMAEHMLILKLISPEGKAYHICAAFPSQCGKTNLAMIQPTIPGWKAEVIGDDIAWL
HFGDDGRLYAVNPENGFFGVAPGTNYKSNPNAMKTMEAGNNIFTNVALTDDGDVWWEGLE
NEPDHLIDWKGKDWTPDEDCLSSHPNSRYCVPIEQCPVAAPEFNDPKGVPVDAILFGGRR
PDTVPLVTEAIDWQHATFIGATLASGQTAAAAEAKVGTLRYDPMAMLPFIGYNVGDYLQH
WLDIGKKGGDKLPKVFLVNWFRRGDDGRFLWPGFGENSRVLKWIVDRIEGRVDAKKTVVG
YTAYSKDIDIDGLDTDPKDVKAALTAPADKWQMDLSDTEDWLKSLGPKVPQEIWDEFDFL
KTRIKTANKDGNKALDNMKTK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcacctacgatcccggggctcgaaggtaatgcccctacgacaaaccaagacatg
ctcaattggatcgcggagtgcgctgaactgtgtcagccggataaggtcgttttctgcgac
ggctcagatgaagagtgggaagccatcgcaaaagatctcgtcgaaaaggggaccctcatc
aagctgaatgaggagaagcgccccaattcgtacttagcctcatcggatcccgccgacgtt
gctcgcgttgaatcccggacattcatctgctcgaagaccgaagatggcgccggcccgacg
aacaactggcgcgacccggacgaaatgcgcgccgaaatgagcgagcactttaagggatcg
atgaagggccggaccatgtacgtggttccgttctgcatgggcccgattaccgaccccgac
cccaagctggggattgagctcaccgactccggctatgtcgtgatgtcgatgcgcattatg
acccgcatgggcaaggaagccctcgataagatcggcgacggccccttcgtgaagggcctg
cactcggtaggtgccccactggagccgggccaagaggacgtcaagtggccgtgcaacgaa
acgaagtacattacgcagttccctgaggaccgagtgatctggtcctacggctccggctac
ggtggcaacgccatcttggcgaagaagtgctacgccctccgcatcgcatctgtcatggcc
aaggacgaaggctggatggcagagcacatgctgatcctgaagctgatctcacccgagggc
aaggcctaccacatttgcgctgccttcccgtcccagtgcggtaagaccaacctcgcgatg
atccaaccgaccatccccggctggaaagccgaagtcatcggcgacgacatcgcatggctg
cactttggcgacgacggtcggctctacgcagtcaacccggaaaacggcttcttcggcgtc
gcccccgggacgaactacaagtccaaccccaacgccatgaagacaatggaggcggggaac
aacatcttcaccaacgttgccttgaccgacgatggggacgtctggtgggaaggcctcgaa
aacgagccagaccacttaatcgactggaagggcaaggactggacacccgacgaagactgc
ttgtcctcgcacccgaactccaggtactgcgtaccgatcgagcagtgcccggtcgccgcg
cccgagttcaatgatccgaagggtgtgccggtcgacgcgatcctgttcggtggacgccgc
cccgacactgtcccgctggtgaccgaagctatcgactggcagcacgccaccttcattggt
gccacgctggcttccggccaaaccgccgccgctgccgaggccaaggttggcaccttgcgc
tacgaccccatggccatgcttcccttcatcggctacaacgtgggcgattacctccagcac
tggctggacatcggcaagaagggtggagacaaactccccaaggtcttcctggttaactgg
ttccgccgcggcgacgacggccgtttcctctggcccggcttcggtgaaaacagccgtgtc
ctcaagtggattgtggatcgtatcgaggggcgcgtcgatgcgaagaagacagtggttgga
tacaccgcctactcgaaggacatcgatatcgatggcctggacacggaccccaaggatgtc
aaagctgcgctgaccgcacctgcggataagtggcagatggatctctccgataccgaggat
tggttgaagagcttgggaccgaaagttccgcaggagatttgggacgagttcgacttcctc
aagaccaggattaagacagccaacaaggatggcaacaaggccctggacaacatgaagacg
aagtaa

DBGET integrated database retrieval system