KEGG   Corynebacterium kroppenstedtii: ckrop_0638Help
Entry
ckrop_0638        CDS       T00896                                 

Definition
(GenBank) putative SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ckp  Corynebacterium kroppenstedtii
Brite
KEGG Orthology (KO) [BR:ckp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ckp03009]
    ckrop_0638
Enzymes [BR:ckp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     ckrop_0638
Ribosome biogenesis [BR:ckp03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ckrop_0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31 Ubie_methyltran Methyltransf_23 FTCD_N
Motif
Other DBs
NCBI-ProteinID: ACR17401
UniProt: C4LHU6
Position
749511..750383
Genome map
AA seq 290 aa AA seqDB search
MLSDVLDVLSDPIDGSSLHDGGNLATLVSDTGHSYDVARQGYVSLVGGRGLRYKGDDASM
IQAREKFLASGHFGPFVEAVTGNVQDVLDDAGVGDHEHPVVMEVGAGTGYYLAHTLDAVP
GSRGIGIDVSVPAAKRIAGCHPRAGAVIADAWSRLPVKDKSIDTITVVFAPRNAEEFARV
LTDGGQVVVLTAAPGHLAELREPLGIIDVEKNKVHRMIQQASGHLTPDGEPEEVEFEMNL
GRDAIEAQVGMSPSARHIRPEDLKERIATLPDSMTVTARATVTRLKKNHR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
ttgctctccgacgttcttgatgttttatctgaccccatcgacggctcttcgctccacgat
ggcggtaatttagccacccttgtctctgataccggccatagttacgacgttgcccgccag
gggtatgtgtcccttgtgggcgggcgtggcctgagatataagggcgacgatgcctcgatg
attcaggcccgcgaaaagtttcttgccagtggtcattttggcccattcgttgaggccgtg
acggggaatgtgcaggatgttctcgatgatgcgggggtaggcgatcacgagcatcctgtc
gtcatggaagtgggcgcggggaccggctattacttagcccacacactcgacgccgttccg
ggttcgcgcggaatcggcattgacgtttctgttcctgctgctaagcgcatcgctggctgc
caccctcgtgcgggagctgttattgctgatgcatggtccaggcttcctgtcaaagataag
tccatcgacacgattaccgtcgttttcgcgccgcgtaacgcggaagaattcgcgcgagtt
cttaccgacggaggacaagttgtcgttttgacagccgcgcccggtcatttagctgagctt
cgcgagccccttggaattattgacgttgaaaagaacaaagttcaccgaatgattcagcag
gcgtcggggcaccttacccctgatggcgagcctgaagaggttgaattcgagatgaatctg
ggccgcgatgctattgaagctcaggtggggatgagcccgtctgctcggcacattcgtccg
gaggatttaaaggagagaattgcaaccttgccggactcgatgacagtgactgcgcgcgcc
acggtgacgaggttaaaaaagaaccataggtag

DBGET integrated database retrieval system