KEGG   Corynebacterium kroppenstedtii: ckrop_1158Help
Entry
ckrop_1158        CDS       T00896                                 

Gene name
cobQ
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ckp  Corynebacterium kroppenstedtii
Pathway
ckp00860  Porphyrin and chlorophyll metabolism
ckp01100  Metabolic pathways
Module
ckp_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ckp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ckrop_1158 (cobQ)
Enzymes [BR:ckp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     ckrop_1158 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase DJ-1_PfpI VirC1
Motif
Other DBs
NCBI-ProteinID: ACR17903
UniProt: C4LJ98
Position
complement(1372799..1374463)
Genome map
AA seq 554 aa AA seqDB search
MNADYEKAGYDKAESSLAPALLVTGCTSDAGKSVVVAGMCRSLARRGYRVAPFKAQNMSN
NSAVVLATDCSTGAGNSGSGEAASHLASTHGDGQRLVAGEIGRAQALQAFAAGATPSVDM
NPVLLKPEADRRSQLVLRGVAAGTVGARDYIEHRTHLREVSAQALESLRREYDVLICEGA
GSPAEINLRHTDIANMGLAEAADLPAVLVGDIDRGGVLAHFFGTYFILDPSDRDRFQGFI
VNKFRGDVGILQPGLDEVTRRTGVPTLGVIPFIDGLWIDAEDSLSGASGRVGPGLPPIGT
DTIRVAAVRLPRVSNSTDIEALSCEPGVDVEWTTSPAAIASADLVVIPGSKSTIHDLEWL
TKTAGPQLQERYRAGRPILGICGGFQMLCHSITDPVESGHSEPVAGLDFLDIDIEFFPEK
TLANHGTAFEIHHGRVVRQNCPGWIGPLPGDESSGDHVGPDEHANSGNDVSSAAGYEGAH
DEAVWGTHRHGQLEVDSFRRQFLRDVARTCGLSGFIPGDVSFYDARAEQVDRLADAVDAA
LGDDWPERLGIVTD
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgactatgaaaaggccgggtacgacaaggctgagtcttccttagccccggca
ctgttggtgaccggatgtacatcagacgctggcaagtcggtcgtcgttgctggcatgtgc
cggtcattggcacgtcggggttaccgtgtcgcgcctttcaaggcgcagaacatgtcgaat
aattcggccgtcgtgctggcgacggattgttcaacaggtgcgggcaactcggggagtggg
gaagcggcctcgcatctggcttccactcacggggatggtcaacgtctcgtcgctggggaa
atcggacgagcccaggcattgcaagctttcgcggcaggcgcgactcccagcgtcgatatg
aacccggtcctgctgaaaccggaggcagaccgtcgaagccaactagtcctccgcggagtc
gcagccggcaccgtcggcgcgcgggattacattgaacaccgcacgcacttgcgtgaggtc
agcgctcaagcgttggagtcgctccgccgcgaatacgatgtgctcatctgtgaaggggcg
ggttcaccagcagaaattaacctccgccacaccgacatcgcgaacatggggctcgcagaa
gctgcggatcttcccgccgtcctcgtcggcgatatcgatcgcggcggtgtgctcgcgcac
ttttttggaacctatttcattctcgaccccagtgaccgcgaccgatttcaaggtttcatt
gtcaacaaattccgcggtgacgtcggcatcctccagcctggattggacgaggtcacacgc
cgaaccggtgttccgacgctcggcgtcatcccattcatcgacggtctctggatagatgct
gaagactcactatcgggtgccagtgggcgagtgggccccggccttccgcctatcgggacc
gacaccatacgggtagccgcggtccgcctaccgcgggtctctaacagcaccgatatcgaa
gctctgtcctgcgagcctggcgttgatgtggaatggaccacctctcccgcggctatcgca
tcggcggatctagtggtcattccggggtcgaagtccacgatccacgacttagagtggttg
acgaaaacagctggccctcagcttcaggaacgctaccgcgccggccggccgattttagga
atatgcggcggattccagatgctctgccactccattacggatcccgtcgagtccggccac
tctgaacccgtcgccggtctggatttcttggacatcgatatcgagtttttccccgaaaaa
acactggccaatcacggtacagcctttgagatccaccacggtcgagttgtccgtcaaaac
tgcccagggtggatcgggccacttccaggtgacgagagttctggcgatcacgtgggccca
gatgaacatgcaaattcaggcaacgacgtcagcagtgcagcaggctacgagggtgcacat
gacgaagccgtgtggggcacacaccggcacgggcagttagaggtcgactctttccgacgc
caattcctccgtgatgttgcacggacctgtggcttatccgggttcatccccggtgacgtg
agtttctacgatgctcgcgctgaacaggtcgatcggttagccgacgctgtggacgcagcc
ctgggcgacgactggcccgaacgattgggaatcgtaacagactag

DBGET integrated database retrieval system