KEGG   Clostridium kluyveri NBRC 12016: CKR_2360
Entry
CKR_2360          CDS       T00832                                 
Name
(GenBank) hypothetical protein
Organism
ckr  Clostridium kluyveri NBRC 12016
SSDB
Motif
Pfam: DUF2815
Other DBs
NCBI-ProteinID: BAH07411
UniProt: B9E4I6
Position
complement(2666118..2666690)
AA seq 190 aa
MKLRRDRNMNNQNRTKVVTSVNTRLSYFHGWEPVSINGGAEKYSVSVLIPKSDKETINAI
NAAVDAAIEEGIAKFGGKKPNKAAIKLPLRDGDVERDDEAYKGHYFVNANSTTPPQIVDK
AVKPILDRNEVYSGCYARVSLNFYAFNSNGNKGVACGLGNIQKIRDGEPLGSRTTAADDF
TTIEDDDFLA
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaaattacggagggataggaatatgaataatcaaaacagaacgaaggttgttacaagc
gtcaacacacgtcttagctactttcacggctgggagcccgtatccatcaatggtggggca
gaaaagtatagtgtatcggtattgattcctaaatcggataaggaaaccattaatgccatc
aatgcagcagttgatgcagctattgaagagggcattgcaaagtttggcggtaaaaaacca
aataaggctgctatcaagctgccgcttcgagatggtgatgtagaacgagatgatgaggct
tataaaggacattattttgtaaatgccaacagcactactccgcctcagattgtagataaa
gcagtcaagcctattctggatcgcaatgaggtatacagtggttgctatgcaagagtgtca
cttaatttctatgctttcaattctaatgggaacaagggtgtggcctgcggacttggtaac
atccagaagattagagacggagagcctttaggcagcagaaccacagcggctgatgatttc
accacaattgaagatgatgatttcctagcataa

DBGET integrated database retrieval system