KEGG   Clostridium kluyveri NBRC 12016: CKR_0641Help
Entry
CKR_0641          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
ckr00860  Porphyrin and chlorophyll metabolism
ckr01100  Metabolic pathways
ckr01110  Biosynthesis of secondary metabolites
ckr01120  Microbial metabolism in diverse environments
Module
ckr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CKR_0641
Enzymes [BR:ckr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CKR_0641
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CKR_0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: BAH05692
UniProt: B9DZL7
Position
712543..714015
Genome map
AA seq 490 aa AA seqDB search
MGKVYLIGAGPGNEELVTLKAVRVLKECTVVLYDRLSGESLLRYLNEDCKIFYCGKEPGC
HYRSQEEINNMLVKFAKEGHIVGRIKGGDPYVFGRGGEEGIRLSKENIPFETVPGITSAI
AVLNYGGIPITHRDISRSFHVFTAMTREGTSLQWEYISKLSGTLVFLMGMEHIGEIFRKL
MENGKNKNTPAAVIMRGTTSRQKMVTGNLMNIVEKAKSENLKAPCIIVVGEVVSLSKYLN
WYNNMELYGTNVCITRSREQSYEVKNKLIELGAEVTEINAIKILNTSENMDGYLNKLHRY
DFIVMTSVNSVNIFFNYLKEKRYDIRNVKGKFAVIGSATERTLMENGIYADMRAKEFSSK
NLEEALMKKVKKSDSILIPCSKLSRGKIAQSLIDFGCQVDEVHIYEPVQGEMSGEKAFDE
VDVVFFTSPSTVRNMINMVGLDKLRRKINIAIGPITFKELEKHSISSLISDEFTTKGMIK
KLLQFKQNKD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtatatttgataggggcaggacctggaaatgaagaattagttactttaaag
gcagtaagagttttaaaggaatgtacggtagtgctatacgacaggctttcaggggaaagt
ttacttagatatttaaatgaggattgcaaaatattttattgtggaaaagaaccaggatgc
cactatagatctcaagaagaaataaataatatgcttgttaagtttgcaaaagagggtcat
atagtcggaagaataaaaggaggagatccttatgtatttggaagagggggagaagaaggc
ataagattaagcaaagagaatattcccttcgaaactgttccaggaattacatctgccata
gctgttttaaattatggtggaattcctattacccatagggacatttcaagaagttttcac
gtgtttacagctatgaccagggaaggaacaagtctccaatgggaatatatttccaagttg
tcgggaaccttggtttttcttatgggaatggagcatataggagaaatatttagaaaactt
atggaaaatgggaaaaataaaaatacccctgcggcagtaataatgagaggaacaacctca
agacaaaagatggtgacgggtaatttgatgaatatagtggaaaaggcgaaaagtgagaac
cttaaagcaccttgtattatagtagttggggaagtggtctctcttagtaaatatttaaac
tggtataataatatggaattatacggcactaatgtgtgcattacaaggagcagggaacaa
tcttatgaagttaaaaataaactgattgaattaggggcagaggtaacggaaatcaatgca
ataaaaattttaaatacctcagaaaatatggatggttatttaaataaacttcacaggtat
gactttatagttatgaccagtgtaaatagtgtaaatatattttttaattatctaaaagaa
aaaagatatgatataagaaatgtaaaagggaaatttgcagtaattggctctgctacggaa
aggactttaatggaaaatggtatatatgcggatatgagggctaaagaattttcaagtaaa
aatttagaggaagcccttatgaaaaaggttaaaaaatctgacagcatattaataccctgt
tccaaactatcacgaggaaaaatagcacaaagtttaattgattttgggtgtcaggtagat
gaagtacatatttatgaaccggtacagggagaaatgtctggtgagaaagcttttgacgaa
gtagatgtggtgttttttacaagcccttctacggtaaggaatatgataaatatggtggga
ttagataagcttcgtagaaaaatcaatatagctatagggcctattacctttaaagaactg
gaaaagcacagtatatccagccttataagtgatgaatttacaacaaaaggtatgattaaa
aaacttttacaatttaagcaaaataaggattag

DBGET integrated database retrieval system