KEGG   Clostridium kluyveri NBRC 12016: CKR_0866Help
Entry
CKR_0866          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
ckr00790  Folate biosynthesis
ckr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ckr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CKR_0866
Enzymes [BR:ckr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CKR_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF FolB
Motif
Other DBs
NCBI-ProteinID: BAH05917
UniProt: B9E092
Position
961712..962269
Genome map
AA seq 185 aa AA seqDB search
MDENKIKDAVRMIIEAIGENPEREGLAETPDRIARMYTEIFSGLKEKPEEHLKKVFTVNN
DDIVLEKDIQFYSMCEHHFMPFYGKTHVAYIPNGKVVGLSKLARTVEVFAKRLQLQERMT
VQIADSIMDYLKVKGVMVVIEAEHMCMTMRGIKKPGSKTVTVATRGIFKNKIEFRNQVYE
MIKMK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaacaagattaaagatgctgtaagaatgattatagaagctataggagaaaat
cctgaaagagagggacttgcagaaacccctgataggattgccagaatgtatactgaaata
ttttccgggctaaaagaaaagccagaagaacatttaaagaaagtatttactgtaaataat
gatgatattgtgttagaaaaagacattcaattttattctatgtgtgaacaccattttatg
cctttttatggaaaaacacatgtagcatatatacccaatggtaaagttgttggattaagt
aagttggcaagaaccgtggaggtatttgcaaaaagacttcaacttcaagaaagaatgact
gttcaaattgcagattcaataatggattatctgaaagtaaaaggagttatggttgttata
gaagcagaacatatgtgtatgactatgagaggaataaaaaaaccaggaagtaaaactgtt
acagttgctaccagaggaatatttaaaaataaaattgaatttagaaatcaagtttatgaa
atgataaaaatgaaataa

DBGET integrated database retrieval system