KEGG   Clostridium kluyveri NBRC 12016: CKR_1902Help
Entry
CKR_1902          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
ckr00740  Riboflavin metabolism
ckr00790  Folate biosynthesis
ckr01100  Metabolic pathways
ckr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CKR_1902
   00790 Folate biosynthesis
    CKR_1902
Enzymes [BR:ckr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CKR_1902
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CKR_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 SANT_DAMP1_like
Motif
Other DBs
NCBI-ProteinID: BAH06953
UniProt: B9E378
Position
complement(2135422..2136633)
Genome map
AA seq 403 aa AA seqDB search
MKIMSNKFNSIEEALEDLKQGKMILVTDDEDRENEGDLICAAEFATQENVNFMAAHAKGL
ICMPMSSKMISKLNLPQMVSNNTDNHETAFTVSIDHVSTTTGISAAERSITALKSVEEGA
KPEDFRRPGHMFPLRAKEYGVLERNGHTEATVDLMKLANLKECGLCCEIMRDDGTMMRTS
ELIEFAEKYQLKFITIKALQEYRKQREKFIEQVVHTKLPTKYGEFVAYGYINKINGEHHM
ALVKGDISKGNSVLCRVHSECLTGDTFGSVRCDCGQQYARAMTQIEEEGQGILLYMNQEG
RGIGIINKLKAYALQDKGLDTVEANIALGFEEDLRDYYAAAQILKDLGVENIRLMTNNPD
KIEQLSNYGINITERVPIQMKASAYDTFYLKTKQEKMGHILNY
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattatgagcaataaatttaatagtattgaagaagctttagaagatcttaaacag
ggtaaaatgattctggtgactgatgatgaagatagggaaaatgaaggagatttaatctgt
gcagcagaatttgcaacccaggaaaatgttaattttatggcagcacatgcaaaaggactt
atctgtatgcctatgagtagtaaaatgatttctaaattaaaccttccacagatggtttca
aataatacagataaccatgaaacagcttttacggtatcaatcgaccatgtaagtacaact
actggcatttcagctgcagaacgttccataactgcattgaaatctgtagaagaaggtgca
aagccagaggattttagaagacctggacatatgtttccactacgtgcaaaggaatatgga
gttctagagcgcaatggacatacagaagctactgttgatcttatgaaactagcaaatctg
aaagaatgtggactttgttgtgagatcatgagagatgacggtaccatgatgaggacttcc
gaactaatagaatttgcggaaaaataccaattaaagtttattacaattaaggctctgcag
gagtatagaaaacaaagggaaaagtttatagaacaggtagtgcatacaaagctgccaaca
aaatatggagaatttgtagcctatggatatataaacaaaataaatggagaacatcacatg
gcacttgtaaaaggggatatttcaaaagggaattcagttttgtgcagagtacattctgaa
tgtcttacaggagatactttcggctctgttagatgtgattgtgggcagcagtatgcaaga
gccatgacccaaattgaagaagaaggacagggcattcttttatacatgaatcaggaggga
cggggcataggtataattaataaattaaaggcttatgcactgcaagataaaggtctagat
actgttgaagcaaatattgcactgggttttgaggaggatttaagagattattatgctgct
gcacaaattttaaaagacttaggtgtggaaaatatacgacttatgacaaataatccagat
aaaatagaacagttatccaattatggtataaatatcacagaaagagtaccaatccaaatg
aaggcatctgcctatgatactttttaccttaaaacaaaacaggaaaaaatggggcatatt
ttaaattattaa

DBGET integrated database retrieval system