KEGG   Clostridium kluyveri NBRC 12016: CKR_3261Help
Entry
CKR_3261          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ckr  Clostridium kluyveri NBRC 12016
Pathway
ckr00071  Fatty acid degradation
ckr00280  Valine, leucine and isoleucine degradation
ckr00310  Lysine degradation
ckr00362  Benzoate degradation
ckr00380  Tryptophan metabolism
ckr00620  Pyruvate metabolism
ckr00630  Glyoxylate and dicarboxylate metabolism
ckr00640  Propanoate metabolism
ckr00650  Butanoate metabolism
ckr00900  Terpenoid backbone biosynthesis
ckr01100  Metabolic pathways
ckr01110  Biosynthesis of secondary metabolites
ckr01120  Microbial metabolism in diverse environments
ckr01130  Biosynthesis of antibiotics
ckr01200  Carbon metabolism
ckr01212  Fatty acid metabolism
ckr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ckr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CKR_3261
   00630 Glyoxylate and dicarboxylate metabolism
    CKR_3261
   00640 Propanoate metabolism
    CKR_3261
   00650 Butanoate metabolism
    CKR_3261
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CKR_3261
   00072 Synthesis and degradation of ketone bodies
    CKR_3261
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CKR_3261
   00310 Lysine degradation
    CKR_3261
   00380 Tryptophan metabolism
    CKR_3261
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CKR_3261
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CKR_3261
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CKR_3261
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ckr04147]
    CKR_3261
Enzymes [BR:ckr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CKR_3261
Exosome [BR:ckr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKR_3261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAH08312
UniProt: B9DX69
Position
complement(3666026..3667207)
Genome map
AA seq 393 aa AA seqDB search
MREVVIVSAVRTAIGSFGGTLKDVSAVDLGAIVIKEAVKRAGIKPEQVDEVIFGNVIQAG
VGQSLARQSAVYAGLPVEVPAFTVNKLCGSGLRTVSLAASLISNGDADTIVVGGSENMSA
SPYLIPKARFGYRMGEAKIYDAMLHDGLIDSFNNYHMGITAENIAEKWGITREDQDKFAL
ASQQKAEAAIKAGKFKDEIVPVTVKMKKKEVVFDTDEDPRFGTTIETLAKLKPAFKRDGT
GTVTAGNSSGINDSSAALILMSADKAKELGVKPMAKYVDFASAGLDPAIMGYGPYYATKK
VLAKTNLTIKDFDLIEANEAFAAQSIAVARDLEFDMSKVNVNGGAIALGHPVGCSGARIL
VTLLHEMQKRDAKKGLATLCIGGGQGTAVVVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtagttattgtaagtgctgtaagaacagcgataggaagttttgggggaact
ttaaaagatgtttctgctgtagatttaggagctatagttataaaagaagcagtaaaaaga
gcaggtatcaaaccagaacaagtagatgaagttatatttggaaatgtaatacaagcaggt
gttggacaaagtttagcaagacaatcagctgtatatgcaggtcttccagtagaagtacca
gctttcacagtgaataagctttgtggttcaggacttagaacagtaagtttagcagctagt
cttatcagcaacggagatgctgatacaattgtagttggtggatcagaaaacatgtctgca
tctccatatttaattccaaaagctagatttggatatagaatgggagaagcaaaaatatat
gatgctatgttacatgatggacttatagattcattcaacaactatcacatgggaatcaca
gctgaaaatatagcagaaaaatggggaataacaagagaagatcaagataaatttgcatta
gcatcccaacagaaggcagaagcagctataaaagcaggaaagttcaaagatgaaatagtt
ccagtaactgtaaaaatgaaaaagaaagaggtagtttttgatactgatgaagatccaaga
tttggtacaactatagaaacattagcaaaattgaaacctgcatttaagagagatggaaca
ggaacagttacagcaggtaattcttcaggaataaatgattcatcagcagcattaatctta
atgagtgcagataaagcaaaggaacttggagttaaaccaatggcaaaatatgttgatttt
gcaagcgcaggattagatccagctatcatgggatatggaccatattatgcaacaaaaaaa
gtgcttgcgaaaactaatttaacaataaaggactttgatttaatagaagcaaatgaagca
tttgcagctcaaagtatagcagtagcaagagatttagaatttgatatgagcaaagtaaat
gtaaatggaggagcaatagctcttggacatccagttggctgctctggtgcaagaatactt
gttacactacttcacgaaatgcaaaagagagatgcaaagaaaggtcttgcaacactttgc
ataggtggaggacaaggaaccgctgtagtagttgaaagataa

DBGET integrated database retrieval system