KEGG   Corynebacterium kutscheri: UL82_02895Help
Entry
UL82_02895        CDS       T03866                                 

Gene name
cat1
Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
cku  Corynebacterium kutscheri
Pathway
cku00020  Citrate cycle (TCA cycle)
cku00620  Pyruvate metabolism
cku00650  Butanoate metabolism
cku01100  Metabolic pathways
cku01110  Biosynthesis of secondary metabolites
cku01120  Microbial metabolism in diverse environments
cku01130  Biosynthesis of antibiotics
cku01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UL82_02895 (cat1)
   00620 Pyruvate metabolism
    UL82_02895 (cat1)
   00650 Butanoate metabolism
    UL82_02895 (cat1)
Enzymes [BR:cku01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     UL82_02895 (cat1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans Phage_rep_org_N
Motif
Other DBs
NCBI-ProteinID: AKE40803
UniProt: A0A0F6R139
Position
605380..606894
Genome map
AA seq 504 aa AA seqDB search
MSDRIANAQLRGKVMSADEAAQFVNNGDNVGISGFTGAGYPKVLPLAIAERAKQMHARGE
QYRIGLFTGASTAPDCDGVLAEADAISFRTPYQSDPILRAKINEGTIDYADYHLSESGIY
VEQGFFGPMNVAIVEAVRITEEGHLIPSSSIGNNVEYLDNAEKIIIEVNSWQSLELEGMA
DIYRINRLPNRQPIPIVEAGQRVGTPYIDIDLAKVVAVVETDAPDRNAPFKPIDDQSRQI
AAHFLDFLEGEVSAGRLSYDGYVMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMVD
LIDAGKMSVASATSFSLSPEYAERMNKEASRYRESIILRPQQISNHPEVVRRLGLIATNG
LIEADIYGNVNSTNVTGSRIMNGVGGSADFTRNAFISSFITPSDAKGGLISAIVPMVSHV
DHTEQDVKVVITEYGYADLRGLAPRQRAEKIIAIAHPDYRPLLQDYYDRALAYAQEKKIM
QTPHLLGEALSFHQRFQETGSMKK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcgtattgcgaatgcccaattgcgtggcaaggtaatgtccgcagatgaggct
gcacaatttgttaacaacggcgataatgtcggaatctctggttttaccggcgcaggttat
ccaaaggtgttgcctcttgctattgccgagcgagcaaagcaaatgcatgcccgtggtgag
cagtaccggattggtctatttaccggtgcttccaccgctccagattgcgatggtgtgctt
gccgaagcagacgccattagtttccgtactccttatcaatctgatccaatcttgcgcgcc
aagattaatgagggaaccattgactatgctgactaccacctttctgagtctggtatatat
gttgagcagggtttctttgggccaatgaatgtcgccattgttgaggctgtacgtattact
gaagaggggcaccttattccttcttcatccattggtaacaatgtggaataccttgacaat
gctgagaagatcatcattgaggtgaattcttggcagtctcttgagcttgagggcatggca
gatatttatcgcattaatcggttgccaaatcgtcagcctatcccaattgttgaggctggt
cagcgcgttggtactccgtatatcgatattgatctagctaaggtggttgctgttgtcgaa
accgatgcaccggatcgtaatgcgccatttaagccaatcgatgaccaatcacgtcagatt
gctgcacacttccttgatttcctagaaggcgaagtttccgccggtcggctcagctacgac
ggttatgttatgcagtcgggtgtaggtaatgttcctaatgctgtgatggccggcttgctt
gattccaagtttgagaatattcaggcctacaccgaagttatccaagatggcatggtagat
cttatcgatgccggcaagatgtcggttgcatctgcaacatctttctccttatcacctgag
tatgcagagcggatgaataaagaagcttcgcggtaccgtgaatccatcatcttgcgacca
cagcagatttccaaccacccggaggttgtgcgtcgacttggattgattgcgacaaatggt
ttgattgaggcggatatttacggcaatgtcaactccactaatgtcactggttctcgcatt
atgaatggtgtaggtggttctgcggacttcacccgtaatgccttcatctcctcatttatc
accccgtctgatgctaaaggtggtctgatttctgcaatcgttcctatggtttctcacgtg
gatcatacggagcaggacgttaaagtcgttattacagaatatggttacgctgacttacgt
ggtttagcaccacgtcagcgtgccgaaaagattatcgctattgcacacccagattaccgt
ccacttttgcaggactactacgatcgtgcattggcttatgcgcaggaaaagaagatcatg
cagacaccacaccttttgggcgaggcattaagcttccatcagcggttccaagaaaccggt
tcgatgaagaaataa

DBGET integrated database retrieval system