KEGG   Corynebacterium kutscheri: UL82_05510Help
Entry
UL82_05510        CDS       T03866                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cku  Corynebacterium kutscheri
Pathway
cku00030  Pentose phosphate pathway
cku00480  Glutathione metabolism
cku01100  Metabolic pathways
cku01110  Biosynthesis of secondary metabolites
cku01120  Microbial metabolism in diverse environments
cku01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    UL82_05510 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UL82_05510 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cku04147]
    UL82_05510 (zwf)
Enzymes [BR:cku01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     UL82_05510 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     UL82_05510 (zwf)
Exosome [BR:cku04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   UL82_05510 (zwf)
  Exosomal proteins of colorectal cancer cells
   UL82_05510 (zwf)
  Exosomal proteins of bladder cancer cells
   UL82_05510 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AKE41277
UniProt: A0A0F6QZP0
Position
1174180..1175733
Genome map
AA seq 517 aa AA seqDB search
MNNTVNMEPIFNDNPLRDDDDKRLPRIAGPCGMVIFGVTGDLARKKLLPAIYDLANRGLL
PAGFALVGYGRRDWSKKDFEEYVLTSVKKGARTEFRDNVWQRLAEGMHFVSGNFDDNQAF
DNLAEKLRELDNHGTAGNWAFYLSVPPAYFSDVCHQLQRSGMAQAPDGSDSWRRVIIEKP
FGHDKKSAEELNRLINAVFPENSVFRIDHYLGKETVQNILALRFANQLFDPLWNSHYVDH
VQITMAEDIGLGGRAGYYDGIGAARDVIQNHLIQLLALIAMEEPIDFTPAELQTEKIKVL
RATRAVEPFAQTTARGQYGSGWQGSEKVVGLREEEGFDPDSKTETYAACTLEINSRRWAG
VPFYLRTGKRLGRRVTEIALVFKDAPHQPFGEGTRHSQGQNVVVIRVQPDEGMLMRFGSK
VPGSAMEVRDVNMDFSYAEAFTEESPEAYERLILDALLDEASLFPTNEEVELSWKILDPV
INYWAEHGQPEKYPAGTWGPESADRMLSSVHRAWRRP
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaccgtaaatatggaaccaatatttaacgataatcccttacgtgatgatgac
gataagcgtcttccgcgtatcgctgggccatgcggcatggtgatcttcggtgttaccggc
gatcttgcgcgcaaaaaattactgcctgccatttatgatctcgctaatcgcggcctcctg
cctgctggttttgcactagtaggctatggtcgccgcgattggagcaaaaaagactttgaa
gaatatgtgttaacttcagttaaaaaaggcgcccgtactgaatttcgcgataacgtatgg
caacgcctggctgaaggtatgcattttgttagcggcaattttgacgataatcaagctttt
gacaatctagctgaaaagctgcgtgagcttgataatcatggtaccgctggcaactgggct
ttttatctttctgtgccgccagcttatttttctgatgtgtgtcaccaattacagcgcagc
ggtatggctcaagcacctgacggtagtgattcttggcgacgagttatcatcgaaaagcct
tttggtcatgataaaaaatctgctgaggaacttaaccgactcattaatgcagtatttcca
gagaactctgttttccgtattgatcactatctaggtaaagagaccgtacaaaatattttg
gcattgcgctttgctaatcagctttttgatccattgtggaattctcactacgtcgatcat
gtgcaaatcaccatggcggaagatattggtttgggcggacgcgctggttattatgacggc
attggtgcagcacgagatgttatccaaaaccaccttattcagttgcttgctcttatcgct
atggaagagccaattgattttactccagctgagttacagaccgagaagatcaaggtatta
cgagctactcgtgcggtagagccttttgctcagactactgctcggggacaatatggctca
ggttggcaaggcagtgagaaggttgttggtctgcgcgaagaagaaggctttgatccagat
tctaagaccgaaacctatgccgcatgcactttagagattaattcgcgtcgttgggcaggc
gtgccattttatttgcgtactggcaaacgtttaggccgtcgcgtaactgaaattgcgctt
gtttttaaagatgctccacatcagccttttggcgagggaacccggcatagtcaaggacaa
aacgttgtagtgatccgggtacagccagatgagggaatgctcatgcgttttggctcaaag
gtacccggttcggcaatggaagttcgggatgtcaatatggacttttcctatgctgaagct
tttactgaagaatcccctgaagcttatgagcgtcttattcttgatgctttgcttgatgag
gcaagcctcttccccactaatgaagaggtggaattaagctggaagattcttgatcccgtt
atcaactattgggcagaacatggccagccggaaaaatatccagcaggcacctgggggcca
gaatctgctgatcgtatgctatcaagtgttcatcgcgcatggcgtcgtccatag

DBGET integrated database retrieval system