KEGG   Corynebacterium kutscheri: UL82_07215Help
Entry
UL82_07215        CDS       T03866                                 

Gene name
aceF
Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cku  Corynebacterium kutscheri
Pathway
cku00020  Citrate cycle (TCA cycle)
cku00310  Lysine degradation
cku00380  Tryptophan metabolism
cku01100  Metabolic pathways
cku01110  Biosynthesis of secondary metabolites
cku01120  Microbial metabolism in diverse environments
cku01130  Biosynthesis of antibiotics
cku01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UL82_07215 (aceF)
  09105 Amino acid metabolism
   00310 Lysine degradation
    UL82_07215 (aceF)
   00380 Tryptophan metabolism
    UL82_07215 (aceF)
Enzymes [BR:cku01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     UL82_07215 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AKE41605
UniProt: A0A0F6R112
Position
1538815..1540503
Genome map
AA seq 562 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDTVEVDESLLEVSTDKVDTEVPSPVAGVLLEIK
FEEDDTVDVGAVIAIIGEPGEESSSSAAASAPEPEKEEAPQTAPAASQTSGSATDVVMPE
LGESVTEGTITQWLKSVGDTVEVDESLLEVSTDKVDTEVPSPVAGTILEILAQEDDTVDV
GAVIAIIGEPGEESSSSAAASAPEPEKEEAPQTAPAASQTSGSAQAATAAQEEKKPAINT
GNVPYVTPLVRKLANKHGVDLSTVTGTGVGGRIRKQDVLAAAEQGSAAASAAPATPAPAA
QAPVAQGARANWSTKRVDPAKAELIGTTKKVNRIREITAKKMVEALQISAQLTHLQEVDM
TKIAELRKANKPAFQQKYGVNLTFLPFFVKAAVEALVSHPNVNASYNAETKEMTYHADVN
VAIAVDTERGLLTPVIHKAQEMTLPELAQAITELADRARNNKLKPQDLSGATFTITNIGS
EGALSDTPILVPPQAGILGTAAIQKRPVVISDGGTDAIAIRQMCYLPFSYDHQIVDGADA
GRFTATIKDRLETGNFESDLGL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcacactccgttgtcatgcccgagctgggcgaatccgtaactgaaggcacaattact
cagtggctcaagtccgtcggcgacaccgtcgaagttgatgaatccctgcttgaggtttcc
accgacaaggtcgacaccgaggttccatcaccagtagccggtgtcttactagaaattaaa
tttgaagaagatgacaccgtcgatgtcggcgcagttatcgctatcatcggtgagccaggc
gaggaatcttcttcttccgctgctgctagtgctcctgaaccagaaaaagaagaagcacca
caaacggcacctgctgcttcccaaacttccggttctgctaccgacgtcgtgatgccagaa
ctaggcgaatccgtaactgaaggcacaattactcagtggctcaagtccgtcggcgacacc
gtcgaagttgatgaatccctgcttgaggtttccaccgacaaggtcgacaccgaggttcca
tcaccagtagccggaaccatccttgaaatcctcgcccaagaagatgacaccgtcgatgtc
ggcgcagttatcgctatcatcggtgagccaggcgaggaatcttcttcttccgctgctgct
agtgctcctgaaccagaaaaagaagaagcaccacaaacggcacctgctgcttcccaaact
tccggttctgcccaggctgctacagctgctcaagaagaaaagaagcctgccattaacact
ggtaatgttccttatgtcactccactagtacgcaagctagccaataagcacggcgttgac
ctttccacggtaacaggtaccggcgttggtgggcgtatccgtaaacaagatgtgcttgct
gctgccgagcagggttctgccgctgctagcgctgccccagccaccccagctcctgctgca
caggctcctgttgcacagggtgcacgtgcaaactggtcgaccaagcgtgttgatcctgct
aaggcagaattaatcggtaccacaaagaaggttaaccgtatccgtgagatcacagctaag
aagatggttgaagcattgcagatctctgcgcagctcacccacctccaagaggttgatatg
actaagattgctgagctgcgcaaggctaacaagcctgccttccagcagaagtatggtgtc
aaccttactttcttgcctttctttgttaaggctgccgtcgaagcgctggtctcccatcca
aatgtcaacgcatcttataatgctgagaccaaggaaatgacctaccacgcagacgtcaat
gttgctattgccgttgataccgagcgtggcttgcttaccccggttattcacaaagcacag
gaaatgactttgccagaattggctcaggctattactgagcttgctgatcgcgcacgcaac
aataagctcaagccacaggatctctctggtgcaacctttaccatcaccaatattggttct
gagggagctttgtctgatactccaatcctggttccaccacaggctggcatcttgggcaca
gctgcaatccaaaaacgcccagtggtcatttccgatggcggaacggacgctattgctatc
cgacaaatgtgctatctgccattctcttatgatcaccagattgttgatggtgcagatgct
ggtcgtttcaccgcaactatcaaggatcgtctagaaactggtaacttcgagtctgatctc
ggcctctaa

DBGET integrated database retrieval system