KEGG   Corynebacterium kutscheri: UL82_07225Help
Entry
UL82_07225        CDS       T03866                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
cku  Corynebacterium kutscheri
Pathway
cku00260  Glycine, serine and threonine metabolism
cku00630  Glyoxylate and dicarboxylate metabolism
cku00670  One carbon pool by folate
cku01100  Metabolic pathways
cku01110  Biosynthesis of secondary metabolites
cku01130  Biosynthesis of antibiotics
cku01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    UL82_07225 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UL82_07225 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    UL82_07225 (gcvT)
Enzymes [BR:cku01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     UL82_07225 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AKE41607
UniProt: A0A0F6R0A0
Position
1543718..1544827
Genome map
AA seq 369 aa AA seqDB search
MTDLRLSPLHEVHEKLGASFTAFGDWNMPLKYGRELEEHHAVRTTAGLFDLSHMGEIRVS
GNDAGAFLDYALISQLSNIAVHRAKYSMIVAEDGGIIDDLISYRLGEEEFLVVPNAGNAQ
VVFDELERRAHGFDVAVVNESQETALIAIQGPKAEEILLKIVDTHNAKTLTTMKYYACAP
AVVAGFEVLLARTGYTGEDGFELYINNEHALALWHAISEAGQDLGLIPAGLAARDSLRLE
AGMPLYGNELSRELTPHDAGLGVLIGKKKEADFVAKDVLLNAQAPKKVLVGIVSDDRRAA
RSGALLFDAEGTEVGIVTSGQPSPTLGHPIALAYIRRDWATPGTHVHADIRGKRYPFKVV
ELPFYKRNS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctacgtctttctccactacatgaagtacatgaaaagctcggagcctctttt
actgctttcggtgattggaacatgccgctgaaatatggcagagagcttgaagaacaccac
gcagttcgcactacagcggggttatttgatctttcccatatgggtgaaattcgcgtgagc
ggaaatgatgccggtgcgtttttggattacgctttaatctctcaactatcaaatattgca
gtgcatagagcaaaatattccatgattgttgccgaagatggtggcattatcgacgatctc
attagctaccgcttaggcgaagaagaattcttggtggtgcccaatgcgggtaatgcgcaa
gtggtttttgacgaattagaacgccgcgcacacggctttgatgtagcggtagttaatgaa
tcacaagaaactgcattaatcgctattcaagggccaaaagctgaggagatcctgcttaag
atcgtcgatacgcacaatgcgaaaactctgacaacgatgaaatactatgcctgtgcccca
gcggttgttgctggttttgaggtattgcttgcccgtactggctataccggtgaggatggc
ttcgaactatatattaataatgaacacgctctggctttatggcatgcgatcagtgaagca
ggacaagatcttgggttgattccagctgggttagctgcgcgcgattctttgcgtctagaa
gctggaatgccgctttatggcaatgagcttagtcgtgagttaaccccacatgatgctggc
ctgggagtgttgatcggcaagaagaaggaagcagattttgtagccaaagatgtactgctt
aatgctcaagccccaaaaaaggttctcgttggcatagtctctgatgatcgtcgagctgct
cgtagcggggcattgcttttcgacgccgaaggcaccgaggtaggcattgttacttctggc
cagccctcacctacgctaggtcatcccattgcgcttgcctatatacgccgtgattgggct
actccaggtactcatgtgcatgcagatattcgtggcaagcgttacccatttaaggtggtt
gaattaccgttttataaacgcaactcctga

DBGET integrated database retrieval system