KEGG   Campylobacter lari RM2100: Cla_a028Help
Entry
Cla_a028          CDS       T00858                                 

Definition
(GenBank) putative adhesin/invasin
Organism
cla  Campylobacter lari RM2100
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IAT_beta Big_1
Motif
Other DBs
NCBI-ProteinID: ACM64900
UniProt: B9KGJ3
Position
pCL2100:30763..35142
Genome map
AA seq 1459 aa AA seqDB search
MRTKEGKMKSVIYKKSLKAKYPKKRILRKILLSFLLSSSLINQTHSSVIFDNVDSEIEIL
SKKIISSTNTDNEILPSSAQNTNTIQSQETQVNEASEIIKEEKDSKELSEQEIYAKYAKI
NKEIRSIDKELSNNSNNNELIAKKEQLIQEKNNLDNNLKEINNEEDNTNFQEQTIRKAKV
KAHRIISREKPNVKSKQVEIYRENRILDIENIITNETGTKWAKLANKEEYISAKWLEFDD
KEVIKEHTHTNFKDKKIIKKPFETVYLENPTNANYYNENLKTQKALNDNKKDNNLSKEDQ
EFSNKVMKVIQTAGAIYDSEDSKSKEEIVKNMASSYLNTSANELAKEFIDSLNTSINTDF
SFNYNERSGFSGNAKALLPIVSEDNPKISYFLQSGIGEFANDRTIGHFGGGIRYYPNATA
LNNSGNIMLGLNSVYDHDFSRGHKRMSLGAEAMVDTLAFNANVYQRLSSWIDSYDFDKDY
VQERPANGWDAKIKYAFPSLINVSFFAKMGQWYGNKVGIFGANSVDDLEKNPLIYEGGIS
YSPFPALTFTLSHSRSAESSKKNTSINANINIPLDEKAMKLAFEPKLAGISNTIEGTRTQ
FIDRDYSMVLEYRATPNKYHISYCGDLGNDKHCILLKNGFDEVVKNTPMRVTPTHSCVVF
EKGFDYITDNSGKVYVQIIRSCTPKTDLNAVAGEANGKFPISIIKLDFKIKADPEKIERF
EESLITLAGGNLANNLKVVWRLIGKGELIKTNTSDTTDNNGEAIIKYKADDTMKDKEEVK
VIASVNGVEFKAPVQIMVFGNNDNDLSIDKEVIGNKEIAIATYKNLRPNKTNVKWRLDGE
DKALFILENENKSSTAKELQLIADNKGESKVKIIGLGNNGKVKIFAKNINDESVSEKNKE
LEVKNYKATMILPTHKHPITNTPFENGTIDYVSEFEVKLTGLMPNTKVEWIAKDTQNNKT
LRISNNKETTSNEKGESKVVFEAIKDYNVKNLEITAIYNQSLANKIEVKDNIKLYQYSLA
MNSQKDKLDAYENGLATKNLVLDKTEVKVTGGKPNEKVEWDLTGDGTLSNQELSFDQNGE
AKALLTSKTPFKTPIKIVTSGVGKNSNKVITYDLRTFTPVITYPVFDSTLYGKHEKTIDY
DTDYSILVKGLLPDSIIEPITNGVIKPKSNSVQVNNKGEATIAYHKISDFNTKKIKPQFK
YIKSGDTKETFTMNDINLYQYKLSISSDKTELVGDEIFKVTVRGGKPNASVEWTLTGDGK
ITSKDSKFNAKGEAYLNGQGKSPFNNSINVEAKAFNQILKASAKISIYESRGILAHPTGN
KNGGNGRTALLGNDNGEDGQAFGNYTNGYSIFTLVGHNGNFDLGIYGYKNIEDIRNANIK
ITYTPAYGGNKQWNLNYFISSKIYYLGNTYLPFDMNHYTYLLFSKEEASIPTKQNNGIYK
FEDLNNKYIKPTYLHLKLP
NT seq 4380 nt NT seq  +upstreamnt  +downstreamnt
atgagaactaaagagggtaaaatgaaatcagtaatatataaaaaatctttaaaagcaaaa
tatccaaaaaaaagaatattaagaaaaatcttgttgtcttttttgttaagttcatcttta
ataaatcaaacacactcaagtgttatttttgacaatgtagatagtgagattgaaatatta
agtaaaaaaattatttcatcaaccaatactgataatgaaattttaccttcaagcgcccaa
aacacaaacactattcaatcacaagaaacacaagttaatgaagctagtgaaattataaaa
gaagaaaaagatagtaaagaacttagtgagcaagaaatctatgctaaatatgcaaaaata
aacaaagaaatcagaagtatagacaaagaattaagtaataattcaaacaataatgaacta
attgctaaaaaagaacaactaattcaagaaaaaaataatcttgataataatttaaaagaa
attaataatgaagaagataatacaaattttcaagaacaaactataagaaaagcaaaagta
aaagctcatcgcataatctctagagaaaaaccaaatgtaaaaagcaaacaagtagaaatt
tatagagaaaatagaatattagatattgaaaatattataactaacgaaacaggcactaaa
tgggctaaattagcaaataaagaagaatatatttcagctaagtggcttgagtttgatgat
aaagaagttatcaaagaacacactcatactaattttaaagacaaaaaaattatcaaaaaa
ccttttgaaactgtttatcttgaaaaccctacaaatgcaaattattataatgaaaattta
aaaacacaaaaagctttaaatgataataaaaaagataataatttaagcaaagaagatcaa
gaattttcaaataaagtaatgaaagttattcaaacagctggtgctatttatgatagtgaa
gatagcaaaagcaaagaagaaattgtaaaaaatatggcaagttcttatttaaatacaagt
gcaaatgaactagctaaagaatttattgattcattaaatacttctattaatacagatttt
tcatttaattacaacgaaagaagcggttttagtggtaatgctaaagcacttttacctatt
gtaagtgaagataatccaaaaatatcttattttttacaaagtggtataggcgaatttgct
aatgatagaaccataggacactttggtggtggtataagatattatccaaacgcaacagct
ttaaataattcaggtaatattatgttaggattaaactcagtctatgatcatgattttagc
agagggcataaaagaatgtctttgggtgctgaagctatggtagatacacttgcatttaat
gcaaatgtatatcaaagattaagtagctggatagatagctatgattttgataaagattat
gtgcaagaacgccctgcaaatggctgggacgcaaaaataaaatatgcctttccttctctt
attaatgtttcattttttgcaaaaatgggacaatggtatggcaataaagtaggtattttt
ggagcaaatagcgttgatgatttagagaaaaatccattaatatatgaagggggaatttca
tattctccattccctgcactaacttttactttaagtcatagcagaagtgcagagagttct
aaaaagaatacttcaattaatgcaaacattaatataccacttgatgaaaaagctatgaaa
ttagcatttgagccaaaactagcaggaattagtaatactattgaaggcactagaactcaa
tttattgatagagattattctatggttcttgaatatagagcaactccaaataagtatcat
atttcttattgtggggatttaggtaatgataaacattgtatattgctaaaaaatggcttt
gatgaagtagtaaaaaatactcctatgagagttacaccaactcattcttgtgtagtattt
gaaaaaggttttgattatattacagacaatagcggaaaagtttatgtgcaaattattcgt
tcttgcactccaaaaactgatttaaatgcagtagctggcgaagcaaatggtaaatttcct
atttcaattataaaacttgattttaaaattaaagcagatcctgaaaaaatagaaagattt
gaagaaagtcttatcactttagcaggtggaaacttagctaataatttaaaagttgtttgg
agattaataggcaaaggtgaattaataaaaacaaatacttcagatacaactgataacaat
ggtgaagctattatcaaatacaaagctgatgatactatgaaagacaaagaagaagttaaa
gttattgctagtgttaatggggttgagtttaaagcacctgtgcaaattatggtatttggt
aataacgataatgatttaagcattgataaagaagtcataggaaataaagaaatagctatt
gctacttataaaaatttacgcccaaataaaactaatgtaaagtggagattagatggcgag
gataaagctttattcatcctagaaaatgaaaataaaagctctactgctaaagaattacaa
cttattgcagataataaaggcgaaagcaaagttaaaatcataggattgggaaataatggc
aaggtaaaaatctttgctaaaaatattaatgatgaatcagttagcgaaaaaaacaaagaa
ttagaggttaaaaattataaagctactatgattttaccaacacataaacacccaattaca
aatactccatttgaaaatggaacaattgattatgtgagtgagtttgaagttaaacttaca
ggattaatgccaaatactaaagtagaatggatagcaaaagatacacagaataataaaaca
ttaagaattagcaataacaaagaaactacttcaaatgaaaaaggcgagagtaaagtagta
tttgaagcaatcaaagattataatgttaaaaatttagaaattacagctatttataatcaa
agtcttgcaaacaaaattgaagttaaagataatatcaaactttatcaatattctttagca
atgaatagtcaaaaagataagcttgacgcttatgaaaatggcttagctacaaaaaattta
gttttagataaaactgaagttaaagttacaggtggaaagccaaatgaaaaagtagaatgg
gatttaactggcgatggcacattaagtaatcaagaattaagctttgatcaaaatggagaa
gctaaagctttattgacttcaaaaactccatttaaaactcctatcaaaattgttacttca
ggtgtaggaaaaaattcaaataaagttataacatatgatctaagaacatttacaccagta
ataacatatccagtatttgattctactctttacggcaaacacgaaaaaactatagattat
gatacagattattctattttagtaaaaggacttttacctgatagcataatagaacctatt
acaaatggagtaattaaaccaaaaagcaatagtgtgcaagtaaataacaaaggagaagcg
acaattgcttatcacaagataagtgattttaatactaaaaaaataaaaccacaatttaaa
tatattaaaagtggagatactaaagaaacttttactatgaatgatattaatttgtatcaa
tacaaattaagcatttcaagtgataaaactgaacttgtaggcgatgaaatatttaaagta
acagtgagaggtggaaaaccaaacgcaagtgtagaatggactttaactggagatggaaaa
attacctcaaaagatagtaaatttaatgctaaaggcgaggcttatttaaatggtcaagga
aaatcaccctttaataacagcataaatgtggaagctaaagcttttaatcaaatattaaaa
gctagtgctaaaattagtatttatgaatctagaggaatattagctcatcctacaggaaat
aaaaatggtggaaatggaagaactgcattattaggaaatgataatggagaagatggacaa
gcttttggtaattatacaaacggatactctatttttactttagtaggacataatggtaat
tttgatttgggaatttatggatataaaaatattgaagatataagaaatgcaaatatcaaa
atcacctatactcctgcatatggaggaaataaacaatggaatttaaattattttattagt
tcaaaaatttattatttaggaaatacatatttaccttttgatatgaatcattatacttat
ttattattcagcaaggaagaagcttctattccaactaaacaaaacaacggaatttataag
tttgaagatttaaataataaatacataaagcccacttatttgcacttgaaattaccttga

DBGET integrated database retrieval system