KEGG   Clostridium sp. BNL1100: Clo1100_0410Help
Entry
Clo1100_0410      CDS       T01708                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
clb  Clostridium sp. BNL1100
Pathway
clb00340  Histidine metabolism
clb01100  Metabolic pathways
clb01110  Biosynthesis of secondary metabolites
clb01230  Biosynthesis of amino acids
Module
clb_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Clo1100_0410
Enzymes [BR:clb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Clo1100_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEY64696
UniProt: H2JI45
Position
457242..458546
Genome map
AA seq 434 aa AA seqDB search
MLNIVDLRSDFDGSAAKDLYRKLTQRTGTQNGGNVINIVAEIIDNVKENGDIALKEYTKK
FDKAEIETIKVSEEEITSAYKKVDPQLLETIKKSRQNIWSFHEKQLQNSWINPKEDGTML
GQLVRPLEKVGLYVPGGTAPLISSVLMTAVPAKVAGVEKLIMCTPPSQDGSINSAILVAA
REAGVDEVYRAGGAQAVAAMAYGTETIPSVDKICGPGNIYVATAKRLVFGDCDIDMFAGP
SEILVIADSSAVPEYVAADLISQAEHDILASSVLVTDDVSLLDSVKTQIEKQLLILKRNE
IIEKSLKNYGFGILVDNIEEAIEVSNNIAPEHLELCIKEPMSILGMIKNAGAIFVGNYSP
EPLGDYMAGPSHVLPTSGTARFSSPVNVDQFIKKSSLIYYNKKSLETTSNDIVRFAEAEL
LDAHANAIKVRFNK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacattgtagatttacgcagtgactttgacgggtctgccgcaaaggatttatac
agaaaattaacacagagaaccggaacccaaaacggcgggaacgtaatcaacattgtagca
gaaataattgacaacgttaaagaaaatggtgacattgctttaaaagaatacacaaagaaa
ttcgataaagcagaaattgaaaccataaaagtctcggaagaggaaattacctctgcatac
aaaaaggttgacccacagctattggagactataaaaaaatcaagacagaatatatggagc
tttcatgaaaaacagcttcaaaacagctggataaatccaaaagaagacggaaccatgctg
ggacagcttgtaagacctcttgaaaaggtaggcttatatgttcccgggggaacagcacca
cttatatcatcggtattgatgacagcggttcccgcaaaagtagccggagtggaaaagctc
ataatgtgtacaccaccttcacaggatggaagcataaactccgcaatactggttgcagcc
agagaagcaggggtggatgaggtatacagagccggaggcgcacaggctgtggccgcaatg
gcatatggaacagaaacaataccgtcggtggataagatatgcggccccggcaatatttat
gttgctacagccaagagactggtttttggagactgcgacattgatatgtttgcaggtcca
agcgagatactggtaattgcagattcaagtgcagtacccgagtacgtagctgcggacctc
atttcacaggcggagcatgacatattggcatcctcggtgctggttacagatgatgtaagt
cttttggacagcgtaaaaactcaaatagaaaagcagcttttaattctaaaaaggaacgaa
ataatcgagaaatcattaaaaaactatggattcggaatactggttgataacatagaagag
gcaatagaggtatcaaataacatagcacctgagcacttagagttatgtataaaagagcca
atgagtatactgggaatgataaaaaatgcgggagcaatattcgttggaaactattcaccc
gaacccttgggagactacatggcagggccgagtcacgttcttccgaccagtggaactgca
aggttttcatcaccagtaaacgtagatcagtttattaaaaaatcaagtttgatttattac
aacaaaaaatcacttgaaacaacaagcaacgatattgtaaggtttgcggaagcggaatta
ttggatgcccatgcaaatgccattaaggtaagattcaataaataa

DBGET integrated database retrieval system