KEGG   Clostridium sp. BNL1100: Clo1100_1077Help
Entry
Clo1100_1077      CDS       T01708                                 

Definition
(GenBank) trehalose/maltose hydrolase or phosphorylase
  KO
K10231  kojibiose phosphorylase [EC:2.4.1.230]
Organism
clb  Clostridium sp. BNL1100
Brite
KEGG Orthology (KO) [BR:clb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Clo1100_1077
Enzymes [BR:clb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.230  kojibiose phosphorylase
     Clo1100_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_65m Glyco_hydro_65N Glyco_hydro_65C Glyco_hyd_65N_2
Motif
Other DBs
NCBI-ProteinID: AEY65329
UniProt: H2JE71
Position
1268156..1270408
Genome map
AA seq 750 aa AA seqDB search
MSKQNKTHVADGLWCIEENRFSLDTNKHFEGLFTQGNGYMHVRGSFEEGLRGAAQDEEYM
RMPANVTLEQPRHTETKWGTFIPGIVGKHPLLKEEIINLPYFLGMDLVIADEKLDMESST
IKDYRRWLDLRDGCLYRSFIWVTENGLNLKLSYKRFVSIEDKHLCLQQLQIEMLSGEGIL
DIRCGIDSEVRTNGFNHFKEVLTEDKHSEYICTKTVTDGGNNVLMLSGINASENICWSKL
TQSKNIFFSGFKLLKAGDSLEVQKVTSVVTDRDLEDGTLIERGQKYLEYFFNQGWEKIYK
RHSMAWNKKWVTSDIEITGDDEAQLAIRTYIYHLIRANSENDSRVAICAKGYAGEAYFGH
YFWDTEINMLPFFIHTNPEAARNLLMYRYNTLNGARKNAMEYGYEGAKYAWEASVTGEEQ
CPCWQYADHEVHVTADIIYAMYHYANATGDTAFVRSFGIDMMVETARYWVQRVDRNNDGY
YDLLGVMGPDEYLPVTRNNAFTNRMVKFSLEKTAELLKKIKHEDKDGYLEIENRLGLKAW
ELDKIKEVGDKLILPYDENSKIVPQSEDFESYADVNFNAIWKDRTKPFGNFISQEKNYRS
KALKQADVIELMMLYPDDFTREQLINAYDYYEPITTHDSSLSASVHGIVAAWMGRMTESE
KFLKKVMAIDMSQEKKGAAEGIHIANCGGLWQMIVYGFAGLKSAMWCEEIQLAPHLPDKW
TNLKFTLAWHGKRYRITVTKDKHEVTELYE
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacaaaataagacacatgtagcagacggtttatggtgtatagaagagaacagg
tttagcctggatacaaacaaacattttgaaggactatttacccagggtaatggctatatg
catgtgagaggaagctttgaggaaggcctccggggagcggcacaggatgaagagtatatg
cgtatgcctgctaatgttacccttgaacagccaaggcacacagaaactaaatggggaacc
tttataccgggtattgtaggaaagcacccgcttctaaaagaggaaataataaatctgcct
tattttcttggtatggacttagtcattgctgatgaaaaattggatatggagtcaagtacc
ataaaggattatagaagatggttggatttgagggacggttgcctttatagaagcttcata
tgggtaacagaaaatggactaaaccttaaacttagttataaacgttttgtcagtatagag
gataaacacctctgtttgcagcagctgcagatagaaatgctctccggagaggggattctt
gacatcagatgcggcatagattcggaagttagaaccaatggttttaatcatttcaaagaa
gtactgacagaggacaagcactcggaatacatttgtacaaagactgttacagatggagga
aacaatgttttaatgctgtcaggtatcaatgcttctgagaatatttgctggagcaagtta
acccaaagcaaaaatatatttttttcaggatttaagttattaaaggccggagatagtctg
gaggttcagaaagtaacgtcggttgtcaccgacagggaccttgaggatggaactcttata
gaaagaggacagaaatatcttgaatacttctttaatcaaggctgggagaaaatatataaa
agacattcaatggcttggaacaaaaaatgggttaccagtgatattgaaataaccggagat
gatgaggcacagcttgcaattcgtacatatatctatcaccttatcagggcaaatagtgaa
aatgactctagagttgctatctgtgcgaagggatacgccggcgaagcatatttcggacat
tatttctgggatacagagataaacatgctacccttcttcattcataccaatcctgaagct
gccagaaacttgttaatgtatagatataacaccctgaatggtgcacggaaaaacgctatg
gaatatgggtatgaaggggcgaaatacgcatgggaggcgtcagttacgggagaagaacaa
tgtccctgctggcagtacgcagatcacgaagtacatgttactgcggatatcatatatgcc
atgtaccattatgcaaacgctacaggagatactgcatttgtcagaagcttcggcattgat
atgatggttgaaactgcaagatattgggtgcaaagggttgacagaaacaatgacggatat
tacgacctgttaggtgttatggggccggatgagtaccttcccgtcacaaggaacaatgca
tttaccaatcgcatggttaagttcagtctggaaaaaacagcagagcttcttaaaaaaatt
aagcatgaagataaagacggatatctggaaattgaaaaccggcttggtttaaaggcgtgg
gagctagacaaaatcaaggaagtcggagataagttaatactcccttatgacgaaaattca
aaaatcgttcctcagtcagaggattttgaaagctatgcggatgttaattttaatgcaatt
tggaaggatagaaccaagcccttcggaaatttcatatcccaggagaaaaactaccgttcc
aaagctttaaagcaggctgatgttattgaactgatgatgctttatcctgatgatttcact
cgtgagcagttaattaatgcctacgactattacgaacctataacaacccatgactcatca
ctttcagcatcggttcacggaatcgtagctgcctggatggggagaatgactgaatctgaa
aaattccttaaaaaggttatggctatagatatgtctcaggagaagaaaggtgcggcagaa
ggtatacacatagcaaactgcggaggtttgtggcagatgattgtatatggctttgccggt
cttaagagtgctatgtggtgtgaggaaatacaattagcaccgcaccttcctgataaatgg
acaaatttgaaatttacactggcatggcatggaaaacggtatagaattaccgttacaaaa
gacaagcatgaggttactgaattatacgagtaa

DBGET integrated database retrieval system