KEGG   Clostridium sp. BNL1100: Clo1100_4033Help
Entry
Clo1100_4033      CDS       T01708                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
clb00010  Glycolysis / Gluconeogenesis
clb00020  Citrate cycle (TCA cycle)
clb00620  Pyruvate metabolism
clb00633  Nitrotoluene degradation
clb00640  Propanoate metabolism
clb00650  Butanoate metabolism
clb00680  Methane metabolism
clb01100  Metabolic pathways
clb01120  Microbial metabolism in diverse environments
clb01130  Biosynthesis of antibiotics
clb01200  Carbon metabolism
Module
clb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1100_4033
   00020 Citrate cycle (TCA cycle)
    Clo1100_4033
   00620 Pyruvate metabolism
    Clo1100_4033
   00640 Propanoate metabolism
    Clo1100_4033
   00650 Butanoate metabolism
    Clo1100_4033
  Energy metabolism
   00680 Methane metabolism
    Clo1100_4033
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clo1100_4033
Enzymes [BR:clb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Clo1100_4033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AEY68134
UniProt: H2JAQ5
Position
complement(4518875..4519753)
Genome map
AA seq 292 aa AA seqDB search
MLNKLDKEEYFYGHKGCGGCGGSLAVRLALKVLGKDTFVVLPAGCMSAVGFVYPQLCFGV
NALISPFASTAAMLSGIRAAAKSLKIENCNVVGFAGDGGTADIGLQALSGAIDRGDKILY
ICYDNEAYMNTGVQQSSLTPYGARTTTTPPGEHIHGSINSKKNMFEIVAAHHIKYAATAS
IGNIPDYIKKVEKAKNTNGTSYIHIAAPCPTGWGIDSSETVAIAREAIECGLWYLAEYED
GKYKLNRDVKEFTSIRTYLKKQGRFKHLTDEDIKEIERQRDEQFKFIKERYI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaacaaattggataaggaagaatacttttatggacataaaggctgcggcggctgc
ggaggaagtcttgcagtaaggcttgcactaaaggttcttggtaaggacactttcgtagta
ctccccgccggctgcatgtctgcagttggatttgtatatcctcagctttgtttcggagta
aatgcattgatatcaccttttgccagtactgcagccatgctgtcaggcatcagggcggca
gccaaatcactaaaaattgaaaattgcaatgttgtaggttttgcaggggacggaggtact
gcggatatcggtcttcaggcattatccggtgcaatagaccggggtgacaaaatcctctat
atttgctacgacaatgaagcatatatgaatacgggagttcaacaaagcagcctgacaccc
tacggtgcaagaacaacaacaacacctcccggtgagcatatacatggaagcataaacagc
aaaaaaaatatgtttgaaatagttgcagcacaccacataaaatatgctgcaacagcaagt
ataggaaatatacccgactatatcaaaaaagttgaaaaagcaaaaaataccaacggcaca
tcatacatacacatcgcagcaccatgccctacgggctgggggatagacagcagtgaaaca
gtagcgattgcaagagaggcaatagaatgtggactttggtatctggcagaatatgaagac
ggaaaatacaagcttaatagagatgtgaaggaattcacgagtatcaggacatatcttaaa
aagcaaggacggttcaagcatctaacggatgaggatattaaggaaattgaaaggcagaga
gacgaacaatttaaatttataaaggaacgatacatatag

DBGET integrated database retrieval system