KEGG   Caldicellulosiruptor lactoaceticus: Calla_0317Help
Entry
Calla_0317        CDS       T01600                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
clc00010  Glycolysis / Gluconeogenesis
clc00052  Galactose metabolism
clc00500  Starch and sucrose metabolism
clc00520  Amino sugar and nucleotide sugar metabolism
clc00521  Streptomycin biosynthesis
clc01100  Metabolic pathways
clc01110  Biosynthesis of secondary metabolites
clc01120  Microbial metabolism in diverse environments
clc01130  Biosynthesis of antibiotics
clc01200  Carbon metabolism
Module
clc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calla_0317
   00052 Galactose metabolism
    Calla_0317
   00500 Starch and sucrose metabolism
    Calla_0317
   00520 Amino sugar and nucleotide sugar metabolism
    Calla_0317
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calla_0317
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Calla_0317
Enzymes [BR:clc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Calla_0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: AEM72985
UniProt: G2PX09
Position
371134..372084
Genome map
AA seq 316 aa AA seqDB search
MYYIGIDLGGTNIAAGIVDEEGKIIKKGSVPTGAHRHYTEIMKDMAELSLNLVKECGLSL
DHIHSVGIGSPGTPDNEKGMILYSNNIAFLNVPMREEIQKYIPKPVNIENDANCAAYGEY
IAGGAKGTKISVTITLGTGIGGGIIIDGKIYTGAHHAGAELGHMVICVDGEQCTCGRKGC
WEAYASATALIRMTREAAARNINGTIMKLVNGDISKIDAKTAFDAKRMGDSEGAAIVDKY
VKYLAEGLVNVCNIFEPEVICIGGGVSKEGEYLLGPVRELVYEKFYCKQISPPKIIPAVL
GNDAGIIGAALLAKQI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgtattacatagggattgacttgggaggaacaaacattgcagcaggaattgtggatgaa
gaaggaaagattataaaaaaaggttctgttccaacaggtgcgcacaggcactacacagag
attatgaaagatatggcagagcttagcctcaatcttgtaaaagaatgcggactttcttta
gaccacattcactcagttggtattggaagccccggtacgcctgacaatgaaaagggcatg
attctttacagcaacaatattgcgtttttgaatgtgcctatgagagaagagatacaaaaa
tatattccaaagcctgtaaacatagaaaacgatgcaaactgtgcagcgtatggtgagtat
atagcaggcggtgcaaaaggcacaaagatttctgttacaatcacattggggactggcatt
ggcggtggaattataattgatggcaaaatatacaccggggcacatcatgcaggtgctgag
cttgggcatatggtgatttgtgttgatggtgagcagtgcacatgtggccgaaaagggtgc
tgggaagcgtatgcgtcagcaacagctcttattcgcatgacaagagaggctgctgcaaga
aatataaacggcacgattatgaaacttgtaaatggcgacatttctaagattgatgctaag
actgcctttgatgcaaagcgaatgggagacagcgaaggtgcagcaattgttgataagtat
gtaaaatatttagcagaagggcttgtaaatgtttgcaatatattcgaaccagaagtaatt
tgcattggcgggggagtcagcaaagaaggggaatacctgcttggaccggtaagagagctt
gtttatgaaaagttctattgcaaacaaatatcaccacctaaaataattcctgctgtctta
ggtaatgatgcaggtataattggtgctgcacttttggcaaagcagatttaa

DBGET integrated database retrieval system