KEGG   Caldicellulosiruptor lactoaceticus: Calla_0776Help
Entry
Calla_0776        CDS       T01600                                 

Definition
(GenBank) Phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
clc00010  Glycolysis / Gluconeogenesis
clc00051  Fructose and mannose metabolism
clc01100  Metabolic pathways
clc01110  Biosynthesis of secondary metabolites
clc01120  Microbial metabolism in diverse environments
clc01130  Biosynthesis of antibiotics
clc01200  Carbon metabolism
clc01230  Biosynthesis of amino acids
Module
clc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
clc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calla_0776
   00051 Fructose and mannose metabolism
    Calla_0776
   00562 Inositol phosphate metabolism
    Calla_0776
Enzymes [BR:clc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Calla_0776
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Calla_0776
Exosome [BR:clc04147]
 Exosomal proteins
  Proteins found in most exosomes
   Calla_0776
  Exosomal proteins of colorectal cancer cells
   Calla_0776
  Exosomal proteins of bladder cancer cells
   Calla_0776
  Exosomal proteins of melanoma cells
   Calla_0776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK TIM SIS_2 DREPP
Motif
Other DBs
NCBI-ProteinID: AEM73428
UniProt: G2PTW0
Position
complement(832562..834514)
Genome map
AA seq 650 aa AA seqDB search
MPKLNKKTIRDIDVAGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVIL
VSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGEDAKKCVEQMKEGDVVLLEN
VRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIE
MLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKS
KCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIG
NTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDS
AAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACLLDKNPRKKIIAANWKMNKTPQE
AKEFVEELKKYIDDVQAEVVICAPSILVPYVKEAIEGTNIKLGTQNMFYEEKGAYTGEIS
GPMLKEVGVEYVVIGHSERRRYFGETDEIVNKKVLAALKFGIKPIVCVGETLKQREYGIT
DELVRLQVKIALNGVPKEDVEKVVIAYEPIWAIGTGKNATPEEANRVIGVIRKVIAEIYD
EDTAQKVRIQYGGSVNSANSADIFNMPEIDGGLVGGASLNAQEFAKILHY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagctcaacaaaaagaccataagagatatagatgttgctggtaagagagttctt
gtgagggttgattttaacgttccacaagatgaaaatggtaatatcactgacgatagaaga
ataagagaagctcttcctacaataaagtatctaattgaccacaacgcaaaggtaatattg
gtatcccatttaggaagaccgaagggcaaatttgacccgaaatactcaatggcccctgtt
gcaaaaagactttctgagcttcttggcaaagaagttgttcttgcaaaagacgttataggc
gaggatgcgaaaaagtgtgttgagcagatgaaagaaggagatgtagttcttcttgaaaat
gtgagattccacaaagaggaagaagaaaacgacagagaatttgcaaaagctttagcatcg
cttgcagacatttatgtcaatgacgcgtttggtacagctcacagagcacatgcatcaaca
gcaggtgttgcagagttcttgcctgcagttgctggatttttgatggaaaaagaaatagag
atgcttggcaatgctcttgcaaatccgcaaagaccttttgttgcaatcttgggtggcgca
aaagtttctgacaagattggggttattacaaatcttcttgagaaggttgatagtctctta
attggcggtgcaatggcttataccttcttgaaggcgaaaggatataaaatcgggaagtca
aaatgcgaagatgataagcttgatgttgcaagagagataatgaaaaaggcagaggaaaaa
ggagtaaaccttttgctgcctgttggaagcatagtagcaaaagagtttaaaaatgataca
gagtttatgtacgtaccatcagatgcaatgccagacgatatgatgggtatggatatagga
aataccacaattgagcttttctcaaaagagataaagaaggcaaagacaattgtttggaac
ggaccaatgggcgtatttgaatttccaaactttgcaaagggaacagaagctattgcaaga
gctgttgctgaggctgttgaagaaaatggcgcaattgcaattatcggtggtggcgactct
gcagctgctgttgaaaaactggggtttgctgataagatgacacatatttcaacaggtggc
ggtgcttcattagagttcttggaaggcaaagttttaccaggtattgcatgtcttcttgat
aaaaacccaagaaaaaagataatcgcagcaaactggaagatgaacaagactccacaagaa
gcaaaagagtttgttgaggagctgaaaaaatatattgatgatgttcaggcagaagtagtt
atctgtgctccatcaattcttgttccttatgttaaagaagcaatagaaggaacaaatata
aaacttggaacacaaaacatgttctatgaagaaaaaggtgcatatacaggtgagatttca
ggtccaatgttaaaggaagttggagttgagtatgtggtaattggtcactctgaaagaagg
cggtactttggtgaaactgatgagattgtgaacaagaaagtgttagcagcgctcaagttt
ggtatcaagcctattgtatgtgttggtgagactttaaaacaaagagagtatggtattact
gatgagcttgtaaggcttcaggtcaagattgcgctaaatggtgttccaaaagaagatgtc
gaaaaggttgtcattgcatatgagcctatctgggcaataggtacaggtaagaatgcaaca
cctgaagaggcaaatagggtaattggagttatcagaaaggtaattgcagagatttacgat
gaagatactgcgcaaaaggttagaattcagtatggcggtagtgtaaactctgcaaattca
gcagacattttcaatatgccagagattgatggaggcttagttggcggtgcaagccttaat
gctcaggaatttgcaaagatattacactactaa

DBGET integrated database retrieval system