KEGG   Caldicellulosiruptor lactoaceticus: Calla_1121Help
Entry
Calla_1121        CDS       T01600                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
clc00010  Glycolysis / Gluconeogenesis
clc00020  Citrate cycle (TCA cycle)
clc00620  Pyruvate metabolism
clc00633  Nitrotoluene degradation
clc00640  Propanoate metabolism
clc00650  Butanoate metabolism
clc00680  Methane metabolism
clc01100  Metabolic pathways
clc01120  Microbial metabolism in diverse environments
clc01130  Biosynthesis of antibiotics
clc01200  Carbon metabolism
Module
clc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calla_1121
   00020 Citrate cycle (TCA cycle)
    Calla_1121
   00620 Pyruvate metabolism
    Calla_1121
   00640 Propanoate metabolism
    Calla_1121
   00650 Butanoate metabolism
    Calla_1121
  Energy metabolism
   00680 Methane metabolism
    Calla_1121
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calla_1121
Enzymes [BR:clc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calla_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II TPP_enzyme_C Transketolase_C Hydrolase
Motif
Other DBs
NCBI-ProteinID: AEM73754
UniProt: G2PWI6
Position
complement(1193370..1195577)
Genome map
AA seq 735 aa AA seqDB search
MIKPQETIFESGNEMAALAASQINYHIMGYYPITPSTQIAEELDQMRADGLHDILLIAAD
GEHGAAGICYGASLGGGRVFNATSANGLMYALEQLPVQSGTRFPMVLNLVTRSISGPLDI
KGDHSDLMFTLNTGWIILLAKDPQRVYDMNIMAVKIGEHPDVNLPVIVAYDGFFTSHQKR
VVSYFKNKEDVQEFVGKLPPKRVVAIDPENPVTIGPYMNEPDLINNKYQLSKAMDKAYEI
IPQVFEEFYKISGRKYELVEGYRMEDAQIAIFALNSTYDTVCEAVDILRQKGIKVGVATT
NVLRPWPKKEIQELLKNVKLLAVLDRQESYGAKGGNMTIEIKATLQELEKGPKVISRIYG
LGGKDFFLEDALTLFEDMNLVLEGKKEIPDFDYIGAYPGDENYVPKRYMKPIKAEWTKNI
PLNTRDLTAMPKRIVPGHGACPGCGIFPNLNLLLKGIEGDVVLLFHTGCGMVVTTAYPQT
AFRTTYVHNLFQNGAATLSGLVEMYNQRRKRGEIPDRDLTFILVTGDGGNDIGMGPTIGA
ALRNHKMIIFEYDNGGYMNTGYQLSYTTPYGASTSTSHVGKAQFGKSTFHKDTPQIMAAT
NIPYVATVAESDPIDFVKKARKAQKIMREEGLVYIKALSACPLNWGDEPSKERRVIQAAV
DCCFHPLYEIDHGKTTITYDPEKKGKKIPVIEWLSMMGRTKHLTRPEYKHIVEEFQAEVD
RRWERLKARHEHPLL
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaccacaagagacaatctttgaaagtgggaatgaaatggcagctttggctgca
tcacagataaattatcatattatgggatactatcctattacaccttctacccagattgct
gaagaacttgaccagatgcgagcagatggacttcatgatattttattgattgcggcagac
ggtgaacatggtgctgcagggatctgttacggtgcttctttgggcggtggcagagttttt
aatgcgacaagtgcaaatgggcttatgtatgctttagagcagcttcctgttcaatctgga
acaagatttccaatggtattaaatcttgttacacgttcaatttctggacctcttgacata
aaaggtgaccatagcgatttgatgttcacattaaataccggctggataatacttcttgcc
aaagacccgcaaagagtctacgacatgaacataatggcagtaaagattggtgaacatcct
gatgtaaatcttcctgtaattgttgcatatgatggattttttacaagccatcaaaagagg
gttgtgagctattttaagaataaagaagatgttcaggagtttgttggaaagctcccgcca
aagcgagtggttgcaatagatcctgaaaatcctgttacaattggaccttatatgaatgaa
cccgaccttataaacaacaaatatcaactcagcaaggcaatggataaagcgtatgagata
attccacaagtattcgaggaattttataagattagcggtagaaaatatgagctggttgaa
ggatatagaatggaagatgcacagatagctatatttgccttaaattccacttatgatacc
gtatgtgaagctgttgacattttaaggcagaaaggtataaaagttggtgttgcaacaaca
aacgtgctaagaccatggccaaaaaaagaaatccaggagcttttgaaaaatgtaaagctt
cttgcagtgttagacaggcaagaaagctacggtgcaaaaggtggcaatatgacaattgaa
atcaaagcaacacttcaagagcttgaaaaaggtccaaaggtaatcagcagaatctatgga
cttggtggcaaggactttttcctggaagatgctctgactctctttgaagatatgaacctt
gtactggaaggcaaaaaagaaataccagattttgattatatcggagcatacccgggagat
gaaaattatgttcctaaaaggtatatgaaacctataaaagcagaatggaccaagaacatt
ccgctaaacacgcgtgatttgacagcaatgccaaaacgaattgttcctggccatggcgca
tgtcctggctgtggtatattccctaacttgaatcttcttttgaaaggtattgaaggtgat
gtggtgcttcttttccatacagggtgtggcatggttgtaaccacagcttatcctcaaaca
gctttcaggacaacttatgttcacaaccttttccaaaatggtgcagcaacactttctgga
cttgttgagatgtacaaccagagaagaaagagaggagaaattcctgacagggacctgaca
tttatccttgtgacaggtgatggtggaaacgacataggtatgggtcctacaattggtgct
gcgctgagaaaccataagatgataatctttgagtacgacaatgggggttatatgaataca
gggtaccagctttcgtacaccacgccttacggagcatctacatcaacttcacatgttgga
aaggctcagtttggaaaatcgaccttccataaagacactcctcagataatggctgcaaca
aatattccatacgttgccacagtggcagaatctgaccctattgattttgtcaaaaaagca
agaaaagctcagaaaatcatgagagaagaagggcttgtgtatatcaaggcactgtcggct
tgcccgcttaactggggtgatgaaccatcaaaggagagaagagttattcaggcagctgtt
gattgctgtttccacccgctctatgagattgaccatgggaagaccactataacatatgat
cctgagaaaaagggtaagaaaatcccagttattgaatggctttcaatgatgggaagaacc
aaacaccttacacgaccagagtacaaacacatcgttgaagaattccaagcggaagttgat
agaagatgggaaaggctgaaagcaagacatgaacatcctctattgtaa

DBGET integrated database retrieval system