KEGG   Caldicellulosiruptor lactoaceticus: Calla_2345Help
Entry
Calla_2345        CDS       T01600                                 

Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
clc00230  Purine metabolism
clc00250  Alanine, aspartate and glutamate metabolism
clc01100  Metabolic pathways
Module
clc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:clc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Calla_2345
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Calla_2345
Enzymes [BR:clc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Calla_2345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt Rubredoxin
Motif
Other DBs
NCBI-ProteinID: AEM74875
UniProt: G2PY08
Position
complement(2489441..2490721)
Genome map
AA seq 426 aa AA seqDB search
MQQIRAIVGTQWGDEGKGKIVDFLAKEADVVVRAQGGNNAGHTVEAFGKVFKLHLIPSGI
LYKDKLNIIGNGVVIDPESLIQEIENLEKEGISTKNLKISDRAHLVMPYHKILDEEQERQ
RGEESLGTTKRGIGPAYADKTERTNLRVCDMLDEEEFIQKLRNVYERKNQILTHVYHKTP
MKFGELLEQFMKYGEILKPYITDTIKLLNDSIKAGKKVLLEGAQATMLDLDYGTYPYVTS
SHPTVGGFCIGAGIAPKYIQEVIGVVKAYTTRVGKGPFPTELLDEVGDSIREKGKEYGTT
TGRPRRCGWLDLVVVRYAVLINGIDKIALTKLDTLSGLPKIKVCRAYKYEGKILELFPAS
LRVARECEPVYEEFEGWSEEEIKAAKEYDQLPRSAKRYIEFIEKETGAKVFLIGTGPARE
DIIIKD
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaatccgcgcgatagttggcacccagtggggtgacgagggaaaaggcaaaatt
gtagactttttggcaaaggaagctgacgttgttgttcgggctcagggcggcaacaacgca
ggtcacacagttgaagctttcggcaaggttttcaagctacaccttataccgtcaggaata
ctttacaaggataagcttaacatcataggaaacggcgttgtgattgatccggaatctctc
atacaggagatagaaaacttagaaaaagagggtatttcgacaaaaaatcttaaaattagt
gacagagcacatcttgtcatgccataccacaagatattagatgaagagcaggaaagacag
agaggcgaagagagccttggcacaacaaaaaggggaataggtcctgcgtatgccgacaag
acagaaagaacaaacctcagagtttgtgacatgcttgacgaggaagagtttattcaaaag
ctcagaaatgtgtatgagagaaagaaccagatacttacccatgtttaccacaaaacacca
atgaagttcggagagcttttggaacagttcatgaaatatggagaaattttaaagccatat
atcacagacacaataaaacttttgaatgattcaataaaggcaggaaaaaaggtgctttta
gaaggtgcacaggcaacaatgcttgatttggattacggaacatacccatatgttacatca
tcgcaccccacagttggtggattttgcattggagcagggattgcaccaaagtacattcaa
gaggtaataggtgttgttaaggcatacaccacaagggttgggaaaggtccatttcccaca
gagcttttggatgaagtaggggatagcatacgcgaaaagggaaaagaatacggaacaacc
accggaagaccaagaagatgcggctggcttgaccttgttgttgtaaggtatgcggtttta
ataaatggaattgacaagattgcccttacaaagcttgatacgctatccggccttccaaaa
ataaaggtttgcagagcctataagtatgaagggaaaatcttagagcttttccctgcgtct
ttgagggttgcaagagagtgtgaacctgtgtatgaggagtttgaaggctggagcgaagag
gagataaaagctgcaaaagagtatgaccagcttccaaggagtgcaaaaagatatatcgaa
tttatagaaaaagagacaggtgcaaaggtttttctcattggcacaggccctgcaagagag
gatataataataaaagactaa

DBGET integrated database retrieval system