KEGG   Clostridium sporogenes: CLSPO_c12960
Entry
CLSPO_c12960      CDS       T03905                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase iron-sulfur-binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cld  Clostridium sporogenes
Pathway
cld00230  Purine metabolism
cld01100  Metabolic pathways
cld01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cld00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLSPO_c12960 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AKC62016
UniProt: A0A1V9IJW0
Position
1409706..1410179
AA seq 157 aa
MSLKRKIKFTVNDKKYEVEIDIRESLSEVLRSRLHLTGVKQGCCVGECGACTVLIDGVPK
DSCIYLAAWADGKAIKTIEGVEKNGELSNVQKAFIDEGAVQCGFCTPGLILTTTALVESG
KDYSDEEIKREISGHLCRCTGYKKIFNATKKAILKRK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgagtttaaaaagaaaaataaaatttacagtaaatgataaaaagtatgaagtagaaata
gatattagagaatctttatcagaagtattaagaagtagattgcatttaacaggtgttaaa
caaggatgttgtgtaggagaatgtggagcatgtactgttttaatagatggtgttccaaaa
gattcatgtatttatttagcagcttgggctgatggtaaagcaataaaaactattgaaggt
gtagaaaaaaatggtgagctttcaaatgttcaaaaagcttttatagatgaaggagctgta
caatgtgggttctgtacaccaggtttaattttaacaacaacagctttagtagaaagcgga
aaagactatagtgatgaggaaataaaaagagaaatatcaggtcatttatgtaggtgtact
ggatataagaaaatatttaatgccactaaaaaggctattttaaaaagaaaataa

DBGET integrated database retrieval system