KEGG   Clostridium sporogenes: CLSPO_c25580Help
Entry
CLSPO_c25580      CDS       T03905                                 

Gene name
ackA
Definition
(GenBank) acetate kinase AckA
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
cld  Clostridium sporogenes
Pathway
cld00430  Taurine and hypotaurine metabolism
cld00620  Pyruvate metabolism
cld00640  Propanoate metabolism
cld00680  Methane metabolism
cld01100  Metabolic pathways
cld01120  Microbial metabolism in diverse environments
cld01200  Carbon metabolism
Module
cld_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:cld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLSPO_c25580 (ackA)
   00640 Propanoate metabolism
    CLSPO_c25580 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    CLSPO_c25580 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CLSPO_c25580 (ackA)
Enzymes [BR:cld01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CLSPO_c25580 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AKC63278
UniProt: A0A1V9IWJ6
Position
complement(2800162..2801355)
Genome map
AA seq 397 aa AA seqDB search
MKILVVNCGSSSLKYQLIDMTSEEALAKGLVERIGIEGSILTQKVNGEKYIIEEPMKDHK
KAIELVLKALVDKDHGVISDMSEIAAVGHRVVHGGEKYASSVLINDEVMKALEDCVKLAP
LHNPPNIIGINACKELMAKTPMVAVFDTAFHQTLPDYAYMYPLPYELYEQNGIRKYGFHG
TSHRYVSSVASEMMGKDLKDIKVITCHLGNGASLCAVKEGKSVETSMGFTPLAGLAMGTR
CGDIDPAILLFMERELNMSPDEVDNVINKKSGVLGISGVSSDFRDIEGAAKEGNKRAKLA
LDVYHYTVRQTIGAYTAVLNGVDAIVFTAGLGENSAASREEILNGLEYLGIKIDAEKNKQ
RGKQIEISTADSKVKVFVIPTDEELMIARDTKEITSK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattagtagttaactgcggaagttcatcattaaaatatcaattaatagatatg
acttctgaagaagctttagcaaaaggattagtagaaagaataggaatagaaggatctata
ttaactcaaaaggttaatggagaaaaatatataatagaagaacctatgaaagatcataaa
aaagctatagagttagttttaaaagcattagtagataaagatcatggagtaatatctgat
atgtcagaaatagcagcagtaggacatagagtagttcatggtggagaaaaatatgctagc
tcagtacttataaatgatgaggttatgaaggctttagaagattgtgttaaattagcacca
cttcataatccaccaaacataataggaataaatgcttgtaaagagcttatggctaaaact
ccaatggtagcagtatttgatacagcattccatcaaacattaccagattatgcatatatg
tatccattaccatatgaattatatgaacaaaatggtataagaaaatatggcttccatgga
acatcacatagatatgtatctagtgtagcgtcagagatgatgggaaaagatcttaaagat
attaaagtaataacttgtcacttaggaaatggagcaagtttatgtgctgtaaaagaagga
aaatcagtagaaacttctatgggattcactccgcttgcaggattagctatgggaactaga
tgcggagatatagacccagcaatacttcttttcatggaaagagaattaaatatgtcacca
gatgaagtagataatgttataaataaaaaatcaggtgtattaggaatatcaggagtaagt
agtgattttagagatatagaaggtgccgcaaaagaaggaaataaaagagctaaactagct
ttagatgtatatcattacacagtaagacaaacaatcggtgcttatacagcagtattaaat
ggtgtagatgctatagtatttacagcaggattaggagaaaattcagcagcaagcagagaa
gaaattttaaatggattagaatatttaggtattaagatagatgccgaaaagaataaacaa
agaggaaaacaaatagaaataagcactgcagattcaaaggtaaaggtattcgttatacca
actgatgaagaattaatgatagcaagagatactaaagaaataacatctaaatag

DBGET integrated database retrieval system