KEGG   Clostridium sporogenes: CLSPO_c33030Help
Entry
CLSPO_c33030      CDS       T03905                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase ThlA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cld  Clostridium sporogenes
Pathway
cld00071  Fatty acid degradation
cld00280  Valine, leucine and isoleucine degradation
cld00310  Lysine degradation
cld00362  Benzoate degradation
cld00380  Tryptophan metabolism
cld00620  Pyruvate metabolism
cld00630  Glyoxylate and dicarboxylate metabolism
cld00640  Propanoate metabolism
cld00650  Butanoate metabolism
cld00900  Terpenoid backbone biosynthesis
cld01100  Metabolic pathways
cld01110  Biosynthesis of secondary metabolites
cld01120  Microbial metabolism in diverse environments
cld01130  Biosynthesis of antibiotics
cld01200  Carbon metabolism
cld01212  Fatty acid metabolism
cld02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLSPO_c33030 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    CLSPO_c33030 (thlA)
   00640 Propanoate metabolism
    CLSPO_c33030 (thlA)
   00650 Butanoate metabolism
    CLSPO_c33030 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLSPO_c33030 (thlA)
   00072 Synthesis and degradation of ketone bodies
    CLSPO_c33030 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLSPO_c33030 (thlA)
   00310 Lysine degradation
    CLSPO_c33030 (thlA)
   00380 Tryptophan metabolism
    CLSPO_c33030 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLSPO_c33030 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLSPO_c33030 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLSPO_c33030 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cld04147]
    CLSPO_c33030 (thlA)
Enzymes [BR:cld01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLSPO_c33030 (thlA)
Exosome [BR:cld04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLSPO_c33030 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKC64016
Position
complement(3621847..3623025)
Genome map
AA seq 392 aa AA seqDB search
MKNVVIASAVRTPIGKFGGTLKSVSAIELGSIVIKEALKRAKVKPEEVDEVIMGNVLQAG
LGQNSTRQSAVAAGIPVEVPSFTINKVCGSGLRSVSLAAQLIKLGDDDIVVAGGTENMSA
APYLLEKARWGQRMGDGKIVDEMIRDGLWESFNDYHMGVTAENIAEQWGITREDQDEFSA
KSQQKAEKAVKEGRFKEEIVPVVIKSKKGETVFDTDEFPRFSTTKESLSKLRPAFKKDGT
VTAGNASGINDGAAALVIMSEEKAKELGVKPLAKIVSYGSSGVDPKIMGYGPFYATKKTL
EKANLKIEDMDLIEANEAFAAQSLAVAKDLGFDMDKVNVNGGAIALGHPIGCSGARILTT
LLYEMGKRDSKHGLATLCIGGGMGTAIIVERY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttgttattgctagtgctgtaagaacacctataggaaaatttggaggaaca
ttaaaaagtgtttcagctatagaattaggaagtattgttattaaagaagctttaaaaaga
gctaaggtaaagccagaagaggttgatgaagttataatgggaaatgtacttcaagcaggg
cttggtcaaaattcaacaaggcaatctgcggtagcagcaggtataccagtagaagtacca
agctttacaataaataaggtgtgtggttcaggacttagatcagtaagtttagcagctcaa
ttaataaaattaggagatgacgatatagtagtagcgggcggtacagaaaatatgtctgca
gctccatatcttttagaaaaagcaagatggggacaaagaatgggagacggaaaaatcgta
gacgaaatgataagagatggactatgggaatcttttaatgactatcatatgggagttaca
gctgaaaatatagcagagcaatggggaataacaagagaagatcaagatgaattttcagct
aaatcacaacagaaagcagaaaaggctgtaaaggaaggaagatttaaagaagaaatagtt
ccagtagttattaaaagtaaaaagggtgaaacagtatttgatactgatgaattccctaga
tttagtactactaaagagagtctctctaaattaagaccagcttttaaaaaagacggaact
gttacagctggtaatgcttcaggtataaatgatggagcagctgctttagttattatgagt
gaagaaaaagcaaaagaattaggagttaaacctttagctaaaatagtttcttatggttct
agtggagtagatccaaagataatgggatatggaccattttatgcaactaaaaaaacttta
gaaaaagcgaacctaaaaatagaagatatggatttaatagaagcaaatgaagcttttgca
gcacagagtttagcagtagctaaagatttaggttttgatatggataaagtaaatgtaaac
ggtggagctatagctttaggacatccaattggatgctcaggagctagaatattaactact
ttattatatgaaatgggaaaaagagattcaaaacatggcttagctactttatgtataggc
ggtggaatgggaactgctattattgttgaaagatattaa

DBGET integrated database retrieval system