KEGG   Cellulosilyticum lentocellum: Clole_0707Help
Entry
Clole_0707        CDS       T01448                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cle  Cellulosilyticum lentocellum
Pathway
cle00260  Glycine, serine and threonine metabolism
cle00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cle01100  Metabolic pathways
cle01110  Biosynthesis of secondary metabolites
cle01130  Biosynthesis of antibiotics
cle01230  Biosynthesis of amino acids
Module
cle_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clole_0707
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clole_0707
Enzymes [BR:cle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clole_0707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ADZ82440
UniProt: F2JNU2
Position
903153..903935
Genome map
AA seq 260 aa AA seqDB search
MSNIQAAFDEKKKEGKKAFIPFITAGDPHIEATEAFIYALEKAGSTLIELGIPFSDPVAD
GPVIQRANLRAMAKGFSLEAVFELVERVREKTRIPLVFLMYANTIHHYGIENFFKRCQEA
GVDGIITPDVPLEEKEEFNSYAKANGVDLIALVAPTSGERIKAICETATGFLYCVSSLGV
TGTRESIETDLGSFFETIKTHCTIPTALGFGISTKEQAVVLKDYADGIIVGSAIVKIVEA
YGEVAAPYLTQFAGDIVKSI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatacaagcagcatttgatgaaaagaagaaggagggaaaaaaagcttttatt
ccttttattacagcaggtgaccctcatatagaagcaacagaggcgtttatctatgcctta
gagaaagcaggaagtacccttattgagcttggcattcctttttcagatccagtagcagat
ggcccagtcattcaaagagctaatttaagggctatggcaaagggttttagtttagaagct
gtttttgaattagtagaaagagtaagagaaaaaacgaggattccactggtatttttaatg
tatgccaatactattcatcactacggaatagagaacttctttaagagatgccaggaagca
ggcgtagatggtattattactccagatgtgcctttagaagaaaaggaagagtttaatagc
tatgcaaaagcaaacggagtagatttaatcgctttagtggcacctacttcgggagaacgt
ataaaggccatatgtgaaacggctacaggtttcttatactgtgtttcttctctgggtgta
acaggaacaagagaaagcatagaaactgatttaggaagtttttttgaaacgattaaaacc
cactgcacgatacccactgccttaggttttggtatttctaccaaggagcaagccgttgta
ttaaaagattatgctgatggcattattgtaggtagtgccattgtgaaaatagttgaagca
tatggagaagtagcagcaccttatttaacacaatttgcaggtgacattgtaaaaagtata
tag

DBGET integrated database retrieval system