KEGG   Cellulosilyticum lentocellum: Clole_1355Help
Entry
Clole_1355        CDS       T01448                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cle  Cellulosilyticum lentocellum
Pathway
cle00260  Glycine, serine and threonine metabolism
cle00750  Vitamin B6 metabolism
cle01100  Metabolic pathways
cle01110  Biosynthesis of secondary metabolites
cle01120  Microbial metabolism in diverse environments
cle01230  Biosynthesis of amino acids
Module
cle_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clole_1355
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Clole_1355
Enzymes [BR:cle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Clole_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADZ83081
UniProt: F2JI53
Position
1547289..1548767
Genome map
AA seq 492 aa AA seqDB search
MLYTSTRKKLENITSTKAILQGISEEGGLFIPTELPKMDFTLDELSKWGYQELAYRVIKL
FFEDIKEEDLKHCITHAYDEKFDTKEITPLVHTKTANFLELFHGPTIAFKDMALSILPYF
MLVSKKYNKEEKDIVILTATSGDTGKAALEGFANVEGTKIIVFFPQDGVSEVQKRQMLTT
EGDNTLVVGVEGNFDDCQTTVKEIFADKEFAKEIADKNYKFSSANSINIGRLVPQVAYYF
AAYGKMMKDGKLKAGEAMNVVVPTGNFGNILAAYYAKQMGLPIQKLICASNTNKVLFDFL
QTGTYDRNRAFHLTTSPSMDILISSNLERLLYHISGESTEEVCSLMNALKTKGQYTISDE
MKANLKDFYGGYADDQMTKDYIKKVYNEENYLMDTHTAVAYAVYDTYVKDTKDHTPTVII
STASPYKFTGSVMSAIDEKYEGVNDFTLLEEMHHLIQGAMPKAMDQIATRPIKHKKVCEV
QGMKQVVSDFLV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctatatacaagtacacgaaagaaattagaaaatattacatcaacaaaggccatttta
caaggtatttctgaagaaggtggtttgtttattcctacagaactacctaaaatggacttt
actttagacgagctatcaaaatggggatatcaagaattagcttatcgtgtgattaagctt
ttctttgaagatataaaagaagaagatcttaaacattgcattactcatgcatatgatgaa
aaatttgatacaaaagaaattacaccacttgtacatacaaaaacagcaaactttttagag
ctttttcacggtcctactattgcatttaaggacatggcattatcaattctaccttatttt
atgcttgtaagtaaaaagtataataaagaagaaaaagatattgtcattttaacagccact
tctggagatacaggtaaagctgctttagaaggatttgctaatgtagagggcactaaaatt
attgtattttttccacaagatggtgtaagtgaggtacaaaaacgccaaatgcttactaca
gagggggataatactttagtagtaggtgtagaaggaaactttgatgattgtcaaacaaca
gttaaagagatttttgcagataaggagtttgctaaggaaatagcggataagaattataaa
ttttcttctgctaactctattaatatcggtagacttgtaccacaagtagcctattatttt
gcagcttatggaaaaatgatgaaggatggaaagcttaaagccggtgaagctatgaatgta
gttgtaccaacaggcaactttggtaacattcttgcagcttattatgcaaaacaaatggga
cttccaattcaaaaacttatctgtgcatctaatacgaataaagtactttttgatttctta
caaacaggtacttacgatagaaatagagcattccatttaacaacttcaccttctatggat
attttaatttctagtaatttagagagactcctttatcatattagtggagagtctacagaa
gaagtctgcagtttgatgaatgctttaaaaacaaaagggcagtatactatatcagatgaa
atgaaagctaatttaaaagatttttatggtggttatgcagatgaccaaatgacaaaagat
tatattaagaaagtatataatgaagaaaattaccttatggacacgcacacagctgtagct
tatgctgtatatgacacttatgtaaaagatacaaaagatcatacaccaacagtgattata
tcaacagcaagcccctataaatttacaggaagtgtaatgagtgcaattgatgagaagtat
gagggggttaatgactttactttattagaagaaatgcatcaccttattcaaggagctatg
ccaaaagctatggaccaaatagcgacaagacctattaagcataaaaaagtatgtgaagta
caaggtatgaagcaagttgttagtgattttttagtataa

DBGET integrated database retrieval system